PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00013311-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SBP
Protein Properties Length: 1065aa    MW: 117911 Da    PI: 8.1383
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00013311-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.4e-41137214178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C++dls+ak+yhrrhkvCe+hsk++++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  WALNUT_00013311-RA 137 MCQVDNCKEDLSNAKDYHRRHKVCEIHSKSSKALVANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 214
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-34131199IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12135212IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-38136216IPR004333Transcription factor, SBP-box
PfamPF031109.1E-30138211IPR004333Transcription factor, SBP-box
SuperFamilySSF484037.46E-5855952IPR020683Ankyrin repeat-containing domain
CDDcd002045.32E-4859955No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1065 aa     Download sequence    Send to blast
MEEAGPQVAS PIFIHQQTLP GPFSLAKKRD LPNIQAPQRM MTPTPGLQNP VMDNWNANVW  60
GWDSFGFVAK PVDLRLGTPR TTTTTAEKNK PLEEEDESLM LNLGGGLKFV EEDSEPPSRS  120
NKRVRSGSPG SGGNYPMCQV DNCKEDLSNA KDYHRRHKVC EIHSKSSKAL VANQMQRFCQ  180
QCSRFHPLSE FDEGKRSCRR RLAGHNRRRR KTQPEDVASR LLLPGNRDNN ASTANLDIVN  240
LLAAIARAQG KNEDKTINCS SVPDRDHLVQ ILSKINSLSL PADLASKLPN LASLTSKLPG  300
HASLEHQIKL NGNPSSPSTM NLLTALSATP ATPTPDATTI LSQKSSQSSD SEKIKITYAD  360
QATPPNLQKR PPLEFRSVGG DRSSSSYQSP MEDSDGQVQD ARVHLPLQLF GSSPEDDSLT  420
KLASSRKYFS SDSSNPIEER SPSSSPVQNL FPMRTKTETM KPEKISIGRG LNANIVASRT  480
ADCNRPFDLF RGSNTGAEPG SFQSFPYQAG YASSGSDHSP SSLNSDAQDR TGRIIFKLFD  540
KDPSHFPVTL RTEIYHWLSN RPSEMESFIR PGCVVLSIYV SMSSAAWEQL EQNLLERVNA  600
LVESSNSDFW RSGRFIVHTG RQLASHKDGK IRLCKSWRTW SSPELILVSP LAVVGGQETP  660
LLLKGRNLSN PGAKIHCTSM GGYISKEITE STCQRTSCDE INLVGFKIQS EAPGVIGRCF  720
IEVENGFKGS CFPVIIADSI ICEELRLLES EFDLGPKEYN VVMEDNKYDF GRPKSREEVL  780
HFLNELGWLF QRKGNTSMLG GPDYSLSRLR FLLTFSVERD CCALVRAILD ILVERNLDGD  840
ELSRESLVTL SEIQLLNRAV KRRCRKMVNM LINYFIISGK DASRKYIFLP NVVGPGGVTP  900
LHLAACTSGS DDLIDALTSD PQEIGLNCWT SLLDASGQSP YAYAMMRSNH SYNKLVARKL  960
TDRENGQVSV TVTSEREQSQ LALEQEHRII TQFKQGPRSC VSCAVVARKY NMRVPASQGL  1020
LQRPFINSML AIAAVCVCVC LFLRGSPDIG SVAPFKWENL DFGTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-32127211184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1857862RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018843080.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2I4GGQ60.0A0A2I4GGQ6_JUGRE; squamosa promoter-binding-like protein 14
STRINGXP_008237887.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]