PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012917-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 315aa    MW: 35410.1 Da    PI: 10.1314
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012917-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3681.7e-11213151301
           GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernka 73 
                         mdd  ++e  r+k  yy+              ++ ++l   +++++ms+iaerd++irern+alsek++a+a+rd+a+ qrd+a+a+r+ a
  WALNUT_00012917-RA   1 MDDGRQHEngRHKLdYYRgshspwnmvpqhqvKEpNALV--MNKKIMSIIAERDSAIRERNAALSEKNEALAARDEALRQRDEAFAQRDSA 89 
                         676665555898887998999999999876653335666..99************************************************ PP

           GAGA_bind  74 lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekka 164
                         l+erdn+l+al++++n++  + p g ++ +g+k +++l + +   +++ +++++e ++++a+pi+  a+ea +++++k+++++k   +k  
  WALNUT_00012917-RA  90 LMERDNALAALQVRDNAM--NFPLGGGIQRGSKRMHHLSN-HLVTMAEAPYNTKEAQITDAFPITVIASEAVKSHQVKRTKENKAISSKPL 177
                         **************9985..568899999*******9988.6699********************99999999999998887777666666 PP

           GAGA_bind 165 kkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaR 254
                         k+++k +++ ++ ++++ +d ++ ++e++s+d++ln v++Des++PvPvCsCtG++rqCYkWGnGGWqS+CCtt +S+yPLP+++++r+aR
  WALNUT_00012917-RA 178 KSPRKGKKVGEDLNRQAASDgTKYRSEWDSQDVGLNLVTFDESSMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTRLSMYPLPQMPNKRHAR 268
                         65555444444434444444488******************************************************************** PP

           GAGA_bind 255 iagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         ++grKmS+++f++lL++LaaeG+dls p+DLkd+WA+HGtn+++ti+
  WALNUT_00012917-RA 269 VGGRKMSGSVFTRLLSRLAAEGHDLSLPLDLKDYWARHGTNRYITIK 315
                         **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.0E-1551315IPR010409GAGA-binding transcriptional activator
PfamPF062173.8E-1031315IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDDGRQHENG RHKLDYYRGS HSPWNMVPQH QVKEPNALVM NKKIMSIIAE RDSAIRERNA  60
ALSEKNEALA ARDEALRQRD EAFAQRDSAL MERDNALAAL QVRDNAMNFP LGGGIQRGSK  120
RMHHLSNHLV TMAEAPYNTK EAQITDAFPI TVIASEAVKS HQVKRTKENK AISSKPLKSP  180
RKGKKVGEDL NRQAASDGTK YRSEWDSQDV GLNLVTFDES SMPVPVCSCT GVPRQCYKWG  240
NGGWQSSCCT TRLSMYPLPQ MPNKRHARVG GRKMSGSVFT RLLSRLAAEG HDLSLPLDLK  300
DYWARHGTNR YITIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018815351.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018815352.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018815353.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-139BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A2I4E7H80.0A0A2I4E7H8_JUGRE; protein BASIC PENTACYSTEINE4-like
STRINGXP_008236825.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-141basic pentacysteine 4