PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012836-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MIKC_MADS
Protein Properties Length: 298aa    MW: 34007.8 Da    PI: 9.5782
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012836-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.1e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+gklye++s
  WALNUT_00012836-RA  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCS 59
                        79***********************************************96 PP

2K-box89.65.7e-3013722710100
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                          +++ es+++e+ +Lk++ ++Lqr+qR+llGedL++L+ ++L++Le+qLe+ lk++Rs+K++++l+q+++lq+ke+ l + n+aL+ kl+e
  WALNUT_00012836-RA 137 PAKELESSYREYLRLKARFDSLQRTQRNLLGEDLGPLNSNDLEKLERQLESTLKQVRSTKTQHMLDQLSDLQNKEQLLLDSNRALTIKLDE 227
                         567899*******************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.9E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.585161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33276IPR002100Transcription factor, MADS-box
CDDcd002651.91E-44276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-32323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-24140225IPR002487Transcription factor, K-box
PROSITE profilePS5129714.39141231IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFCST  60
SSMLKTLERY QKCSYGAVEV NRPAKELEVP CSKHLKGTKS AAMVQWKSTD LPKSLSMLKT  120
LERYQKCSYG AVEVNRPAKE LESSYREYLR LKARFDSLQR TQRNLLGEDL GPLNSNDLEK  180
LERQLESTLK QVRSTKTQHM LDQLSDLQNK EQLLLDSNRA LTIKLDEICS RNHLRQSWDQ  240
GGEQNISYGP QNAQIHGFFQ PLDCNPTLQI GYNASGSDQI TATTHAQQVN GFIPGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-321292251101Developmental protein SEPALLATA 3
4ox0_B2e-321292251101Developmental protein SEPALLATA 3
4ox0_C2e-321292251101Developmental protein SEPALLATA 3
4ox0_D2e-321292251101Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018818572.11e-169PREDICTED: developmental protein SEPALLATA 1-like isoform X2
SwissprotQ8LLR21e-138MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLA0A2I4EGP91e-167A0A2I4EGP9_JUGRE; developmental protein SEPALLATA 1-like isoform X2
STRINGXP_004154725.11e-140(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-113MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]