PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012788-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family CPP
Protein Properties Length: 838aa    MW: 92027.3 Da    PI: 6.7625
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012788-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.4e-16545583240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  WALNUT_00012788-RA 545 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQECFNKP 583
                         689**********************************96 PP

2TCR50.93.2e-16630668139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  WALNUT_00012788-RA 630 RHKRGCNCKKSNCLKKYCECYQGGVGCSISCRCEGCKNA 668
                         589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-17544585IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543545670IPR005172CRC domain
PfamPF036381.7E-11547582IPR005172CRC domain
SMARTSM011145.6E-17630671IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11632668IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MDTPERNQIG TPISKFEFWT NFVHVYLAVF MESSDVYARN VVYHCKQDSP VFNYINSLSP  60
IKPVKSIHIT QTFNPLNFAS LPSVFTSPHV NSHKESRFLK RHNCLDPSKP ESSSGNGNKI  120
GTNEGTGVDA AQLHDNSAEL QENFDSEVSL KVASAQPSSE HSKFVIELPC TLKYDCGSPE  180
CGVTLSCDFE IGCMSELVSK SASLIQYGQE ASGNGSSEGE VHLSEMCRIG QKKEGMECDW  240
ESLISDATDL LIFNSPNNSE AFKGSIQKST DPRIRFSTSL MSELHQNDIK NLQTMQIVDP  300
IGSGEQYETD NPSAETGEGN ELQEIEQTQD NAAESNLSKG MSSHMREQVE SEVAECIPYA  360
SKAVSNLHRG MRRRCLDFEM AGARRKALGD ASNFSSSMLY EKINCYDKQL VAIKPSGDSS  420
RCILPGIGLH LNALATTSKD QKNVKHESLS SGIQLYLPSS TASLHSPTNS QEPLHKSLTS  480
VSAERDTDLA ENGVSHVEDA SQASAYLVSE ELNQNSPKKK RHVHLCIYLN WIFRRRLEHA  540
GESESCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCQECF NKPIHEDTVL ATRKQIESRN  600
PLAFAPKVIR SSESVTEIGD ESSKTPASAR HKRGCNCKKS NCLKKYCECY QGGVGCSISC  660
RCEGCKNAFG RKDGCAPIGT EADIEEETDA CEMEKAIQKS DIQNNEEQNP ATTLPTTPLR  720
LSRPLVPLPF SSNGKLSRSS FLTVGSSSGL YTSQKLGKPN ILRSLPKLGR RFQTVPEDEM  780
PEILCGDSSP STGIKSASPN SKRVSPPHGD FGSSPSRRSG RKLILQSIPS FPSLTPKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1754766712120Protein lin-54 homolog
5fd3_B2e-1754766712120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018818657.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X3
TrEMBLA0A2I4EGY10.0A0A2I4EGY1_JUGRE; protein tesmin/TSO1-like CXC 2 isoform X3
STRINGXP_008224266.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-135Tesmin/TSO1-like CXC domain-containing protein