PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012093-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 337aa    MW: 37214.9 Da    PI: 9.8373
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012093-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind393.14e-12013371301
           GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllal 84 
                         mdd g+re  r+k+ +y++a  + l +++   +q+m++iaerda+++ernlalsekkaa+aerdma lqrd+a+aern+a++erdn++++l
  WALNUT_00012093-RA   1 MDDGGHREngRHKAdQYKSAqgQWLMQHQpsMKQIMTIIAERDAALQERNLALSEKKAAFAERDMAILQRDAAIAERNNAIMERDNAIATL 91 
                         9*****999*****9***655544444432146********************************************************** PP

           GAGA_bind  85 llvensla....salpvgvqvlsgtksidslqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrak.kpkekkakkkk 168
                         +++ensl+    s++p+g+q+++g+k+i++ qq +++ p++++ + ++r++++++ l  ++ ++e+ ++++ k+++++k  + ++ka+k+ 
  WALNUT_00012093-RA  92 QYRENSLSsgnmSSCPPGCQISRGVKHIHHPQQhVHHlPHMGEASNNTRDMHTSDGLAASQVESETAKSRRAKRTKETKgMTTASKASKPP 182
                         ******9999999********************55559**************999998887766666665555443332133333444433 PP

           GAGA_bind 169 kksekskkkvkkesader............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWq 231
                         +k +++ ++ +      +                            sk+++k +dl+ln+vs+D+st+P+PvCsCtG+lrqCYkWGnGGWq
  WALNUT_00012093-RA 183 RKIKSESDDLN------KimfgksqewkggpemgvggddlnrqsgaSKSDWKGQDLGLNQVSFDDSTMPAPVCSCTGILRQCYKWGNGGWQ 267
                         33333333333......123333356899************************************************************** PP

           GAGA_bind 232 SaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         S+CCttt+S+yPLP+++++r+aR++grKmS++af+kl+++LaaeG+dlsnpvDLkdhWAkHGtn+++ti+
  WALNUT_00012093-RA 268 SSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKHGTNRYITIK 337
                         *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062176.8E-1031337IPR010409GAGA-binding transcriptional activator
SMARTSM012261.2E-1751337IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDDGGHRENG RHKADQYKSA QGQWLMQHQP SMKQIMTIIA ERDAALQERN LALSEKKAAF  60
AERDMAILQR DAAIAERNNA IMERDNAIAT LQYRENSLSS GNMSSCPPGC QISRGVKHIH  120
HPQQHVHHLP HMGEASNNTR DMHTSDGLAA SQVESETAKS RRAKRTKETK GMTTASKASK  180
PPRKIKSESD DLNKIMFGKS QEWKGGPEMG VGGDDLNRQS GASKSDWKGQ DLGLNQVSFD  240
DSTMPAPVCS CTGILRQCYK WGNGGWQSSC CTTTLSMYPL PAVPNKRHAR VGGRKMSGSA  300
FNKLISRLAA EGHDLSNPVD LKDHWAKHGT NRYITIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018821117.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_018821118.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_018821119.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_018821120.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_018821121.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
RefseqXP_018821122.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1
SwissprotQ8L9991e-157BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A0B2SGQ80.0A0A0B2SGQ8_GLYSO; Protein BASIC PENTACYSTEINE6
STRINGGLYMA04G02860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-157basic pentacysteine 6
Publications ? help Back to Top
  1. Asamizu E, et al.
    Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    DNA Res., 1998. 5(6): p. 379-91
    [PMID:10048488]