PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011890-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 346aa    MW: 38462.2 Da    PI: 9.0389
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011890-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.2e-18183237256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  WALNUT_00011890-RA 183 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 237
                         778899***********************************************98 PP

2HD-ZIP_I/II126.98.8e-41183273192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eLr +l
  WALNUT_00011890-RA 183 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTQENRRLQKELQELR-AL 272
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  WALNUT_00011890-RA 273 K 273
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-874146IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.0E-17167240IPR009057Homeodomain-like
SuperFamilySSF466892.74E-18174240IPR009057Homeodomain-like
PROSITE profilePS5007117.216179239IPR001356Homeobox domain
SMARTSM003897.7E-16181243IPR001356Homeobox domain
CDDcd000861.07E-15183240No hitNo description
PfamPF000462.9E-15183237IPR001356Homeobox domain
PROSITE patternPS000270214237IPR017970Homeobox, conserved site
PfamPF021834.8E-11239273IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-25239282IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MELALSLGDA PKPFAFLDKT TKMSNSGTTL GFCMGVGSGF SGRSDEKRDT REIGDRREVI  60
RGEGDKKISS DPPVQLDLLP FSPVPRSQPP AQLRFPWLTD NLVSEPGSSD GMGRGLDVNR  120
FPMAIAMDEV DDGADLSSPN STVSSFQMDF SVRNGGRTKR DLDVETERAS SRASDDDENG  180
STRKKLRLSK EQSAFLEESF KEHSTLNPKQ KLALAKQLNL RPRQVEVWFQ NRRARTKLKQ  240
TEVDCEYLKR CCETLTQENR RLQKELQELR ALKTSQPFYM QLPATTLTMC PSCERVATTT  300
TSSNATGTNT TTTTTTTKNS AAALSLSKGR VYQVQPHMHH AQKPTS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181187TRKKLRL
2231239RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007029022.11e-169Homeobox from
SwissprotP466651e-104HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A061F4R61e-169A0A061F4R6_THECC; Homeobox from
STRINGPOPTR_0016s05890.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-89homeobox from Arabidopsis thaliana