PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011814-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 322aa    MW: 36790.6 Da    PI: 6.0854
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011814-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1888141356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t++q+e Le+ Fe ++++  e++ +LAk+l+L+ rqV +WFqNrRa+ k
  WALNUT_00011814-RA  88 KKRRLTADQVELLERSFEVENKLAPERKIQLAKELSLKSRQVAIWFQNRRARFK 141
                         56689***********************************************98 PP

2HD-ZIP_I/II120.96.6e-3988178292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkrrl+++qv+lLE+sFe e+kL perK +la+eL l+ rqva+WFqnrRAR+k+kqlEkdy++Lk++yd+lk + e+L ke+e+L+ +++
  WALNUT_00011814-RA  88 KKRRLTADQVELLERSFEVENKLAPERKIQLAKELSLKSRQVAIWFQNRRARFKSKQLEKDYDSLKACYDKLKVDYENLLKEKESLKIKVN 178
                         9*************************************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1880145IPR009057Homeodomain-like
PROSITE profilePS5007116.92583143IPR001356Homeobox domain
SMARTSM003896.3E-1685147IPR001356Homeobox domain
CDDcd000863.75E-1586144No hitNo description
PfamPF000467.4E-1688141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-1990151IPR009057Homeodomain-like
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PfamPF021834.9E-16143184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVGGKVCGIV SNVSVLSQNE RLPFSSEVLE PLWTPSSNPS LHALKSMVNY ENFSGGNTAA  60
ARPFFQRLDK DEHVDEDYDV GCFHQPGKKR RLTADQVELL ERSFEVENKL APERKIQLAK  120
ELSLKSRQVA IWFQNRRARF KSKQLEKDYD SLKACYDKLK VDYENLLKEK ESLKIKVNSL  180
KDKLLIRGKE MGNAEPLDVI KLLKSEPKET IRNPISENMS NVPKLVCKQE DVSSAKSDVF  240
YSNSPRRTDG KNYSSLLAPA DSCQVFEPDQ SDFLHDEDDN RSQTLLPQPF FLKLEDGCHD  300
PPANYCNFGF PAEDQPFCFW NI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARFKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018819059.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
TrEMBLA0A2I4EI400.0A0A2I4EI40_JUGRE; homeobox-leucine zipper protein ATHB-6-like isoform X1
STRINGXP_007157405.11e-120(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-38homeobox 1