PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011635-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GRAS
Protein Properties Length: 542aa    MW: 60546.8 Da    PI: 6.4117
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011635-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS258.42.6e-791575342374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a+s g+++++q+lL+ l+ela+ +gd+++Rla++ ++ALa++l+   ++++++   ++ ++++     ++l  f+evsP++ 
  WALNUT_00011635-RA 157 EQLLNPCAAAISVGNMSRVQHLLCVLHELANHTGDANHRLAFHGLRALAQHLSI--TSTSSSSVGQTFASTDARFFQQSLLKFYEVSPWFA 245
                         689*************************************************98..55555555555554455566566666********* PP

                GRAS  93 fshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfA 169
                         f + +aN+ Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++++  ++               ++ +rL +fA
  WALNUT_00011635-RA 246 FPNNIANSSILQILAEEpdrsQNLHILDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVIAATVENdqnkespfsVGPPGDNLSSRLLSFA 336
                         **************9999888999************************55566*******997666676676666566678999******* PP

                GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerf 257
                         + ++v++++n l  + l++l+ + +++ ++E+l+V+ +++lh+l    +++++er+e+L+l++s++Pk v+++e+++++   n ++F+++f
  WALNUT_00011635-RA 337 KFMNVNLQINRLDNHPLKSLSAQVINIARDETLIVCAQFRLHHLN---HKSPDERTEFLRLLRSMEPKGVILSENNMECsckNCGDFATGF 424
                         ***********9999*****************************8...66667788*******************9665437888****** PP

                GRAS 258 lealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.s 346
                         ++ ++y + ++ds+ +a  +res++r+ +E      e+ +++++ g++    +e +ekW er++ +GF    ++e+a + a++llrk++ +
  WALNUT_00011635-RA 425 SRRVDYLWRFLDSTsSAFKGRESDDRRLME-----GEAAKALTNWGEM----NEGKEKWCERMRGVGFVGEMFGEDAIDGARALLRKYDsN 506
                         **************4444455556665555.....5588999999998....999**********************************99 PP

                GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                         +++r ee++g+l l Wk++p+ ++S W+
  WALNUT_00011635-RA 507 WEMRPEEKDGCLGLWWKGQPVSFCSLWK 534
                         99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.609130513IPR005202Transcription factor GRAS
PfamPF035149.1E-77157534IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MEEPEPNPTP DHILDWIEDS VSFFPSFLND PYNSDDINGY QWWDESQDLI DSSTVTSLNT  60
TATDTSTAPI NPTIFNQPSP PDSSKKRKAS DHPLPKPSQN HQNPRKNQSR RTRHADDGDA  120
AVEEVVVVKK SVGNKKGTSK ATGSNGNNGN KEGRWAEQLL NPCAAAISVG NMSRVQHLLC  180
VLHELANHTG DANHRLAFHG LRALAQHLSI TSTSSSSVGQ TFASTDARFF QQSLLKFYEV  240
SPWFAFPNNI ANSSILQILA EEPDRSQNLH ILDIGVSHGV QWPTLLEALT RRPGGPPPLV  300
RITVIAATVE NDQNKESPFS VGPPGDNLSS RLLSFAKFMN VNLQINRLDN HPLKSLSAQV  360
INIARDETLI VCAQFRLHHL NHKSPDERTE FLRLLRSMEP KGVILSENNM ECSCKNCGDF  420
ATGFSRRVDY LWRFLDSTSS AFKGRESDDR RLMEGEAAKA LTNWGEMNEG KEKWCERMRG  480
VGFVGEMFGE DAIDGARALL RKYDSNWEMR PEEKDGCLGL WWKGQPVSFC SLWKMDMKTN  540
GS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-3415353484473Protein SHORT-ROOT
5b3h_B7e-3515353430419Protein SHORT-ROOT
5b3h_E7e-3515353430419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018835063.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2I4FTT10.0A0A2I4FTT1_JUGRE; nodulation-signaling pathway 1 protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-166GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]