PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011075-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 218aa    MW: 24980 Da    PI: 7.5949
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011075-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.9e-1957111357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         k+++++++q++ Le +F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  WALNUT_00011075-RA  57 KKRKLSEKQVNLLEVHFGNEHKLESERKDRLASELGLEPRQVAVWFQNRRARWKN 111
                         456899***********************************************95 PP

2HD-ZIP_I/II114.56.5e-3757148293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkr+ls++qv+lLE +F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y+aLk+++++   e+++Le+ev +L+e+l+
  WALNUT_00011075-RA  57 KKRKLSEKQVNLLEVHFGNEHKLESERKDRLASELGLEPRQVAVWFQNRRARWKNKKLEEEYSALKKEHESTIFEKCQLESEVLKLKERLS 147
                         9**************************************************************************************9997 PP

         HD-ZIP_I/II  93 e 93 
                         e
  WALNUT_00011075-RA 148 E 148
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.77952112IPR001356Homeobox domain
SMARTSM003891.2E-1755116IPR001356Homeobox domain
SuperFamilySSF466896.84E-1856121IPR009057Homeodomain-like
CDDcd000861.37E-1457113No hitNo description
PfamPF000462.5E-1657111IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-2059120IPR009057Homeodomain-like
PRINTSPR000311.3E-58392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000311.3E-592108IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MPANMNREDD HIVHFSQSCY ADAYTQMVTQ QGDQTSKPIR RRRKKSKGGN AGDGGAKKRK  60
LSEKQVNLLE VHFGNEHKLE SERKDRLASE LGLEPRQVAV WFQNRRARWK NKKLEEEYSA  120
LKKEHESTIF EKCQLESEVL KLKERLSEAE KEIQRLSQLP AETVPSNSTS SSPSVDTMAG  180
AGQPVLGECE IMDTYTDIFN TTTFYYAHAG MDWISQYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14058RRRKKSKGGNAGDGGAKKR
24259RKKSKGGNAGDGGAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517245.12e-72PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU702e-66ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A0B2RV772e-72A0A0B2RV77_GLYSO; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A0K2CTJ32e-72A0A0K2CTJ3_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1J8X82e-72I1J8X8_SOYBN; Uncharacterized protein
STRINGGLYMA01G38390.15e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.14e-50homeobox protein 40