PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011022-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family ARR-B
Protein Properties Length: 686aa    MW: 75038.1 Da    PI: 5.3845
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011022-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.4e-29212265155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  WALNUT_00011022-RA 212 KPRVVWSVELHRKFVAAVNQL-GFEKAVPKKILDLMNVEGLTRENVASHLQKYRL 265
                         79*******************.9*******************************8 PP

2Response_reg82.81e-27261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll ++l+k +y +v+++ ++  al++l+e++  +Dl++ D++mp+mdG++ll+ +  e  +lp+i++++h++ e++ + 
  WALNUT_00011022-RA  26 VLAVDDNPTCLKLLDTLLRKCQY-QVTTTNQAVMALKMLRENRnkFDLVISDVNMPDMDGFKLLELLGLEM-DLPVIMLSGHSDTELVMKG 114
                         799********************.***************999889*********************96644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  WALNUT_00011022-RA 115 VTHGACDYLLKPVRIEELKN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.6E-1641686IPR017053Response regulator B-type, plant
SuperFamilySSF521722.28E-3623147IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.6E-4323147No hitNo description
SMARTSM004485.4E-3424136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.47325140IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.4E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.32E-2927140No hitNo description
PROSITE profilePS5129413.01209268IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-30209270IPR009057Homeodomain-like
SuperFamilySSF466891.38E-19210269IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24212265IPR006447Myb domain, plants
PfamPF002497.4E-8214264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MTVENQRAGV VVEDMDQDRF PAGMRVLAVD DNPTCLKLLD TLLRKCQYQV TTTNQAVMAL  60
KMLRENRNKF DLVISDVNMP DMDGFKLLEL LGLEMDLPVI MLSGHSDTEL VMKGVTHGAC  120
DYLLKPVRIE ELKNIWQHVI RRKKFDSKVQ NNSLNEDKAC HGAGDSRLGV ISTLSADQDG  180
KLCRKRKEQN EDEEEDDEEN EHENEDASNQ KKPRVVWSVE LHRKFVAAVN QLGFEKAVPK  240
KILDLMNVEG LTRENVASHL QKYRLYLKRI NSVAAQQASM VAALGGADSS YMRMGSLDGF  300
GEFHSLAGSG RLSSSALSSY TPGEMLGRLN SHASLVLRGI TSSGLVQASG QNLSSSINTL  360
GQIQPTPLPS NQSASLFQGV LTSLELTQLQ QSKCTSSTGD FNPIKDSRGF TAVSNGFSDT  420
RVTVGSSTSL LPGASSHPLV LQGNPQLPDD RGAFVNQYSL GVASLTPDTF DIGGGGCSNF  480
LDHSNNESWQ SAIQLSRFSS NAVPLSEPFN HNQFPYNNFV ISSIGPCTTN GPIDFSSRSA  540
ISAPLEDSRG DAHCQEGLMG NVVQDMNYTL KQRWEEHKQD CNQNLNHTVN TKNSVVSANG  600
IISPLGRSLD QNNAICCKSF DVSLISQLHG GALSIGPHGE VEKTALDSKM MINENFLLEQ  660
TKSQDGFIQN NYDSLDDIVN TVTKQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-25210271364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018833533.10.0PREDICTED: two-component response regulator ARR12-like isoform X2
SwissprotQ6K8X61e-147ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2I4FPG80.0A0A2I4FPG8_JUGRE; two-component response regulator ARR12-like isoform X2
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-98response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]