PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00010089-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 387aa    MW: 42711.4 Da    PI: 7.1312
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00010089-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1850110257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         ++R+++++eq+++Le+ F++   +ps++e++++ ++l    ++ +++V++WFqNr+ + k+
  WALNUT_00010089-RA  50 KPRWNPKPEQIRILEAIFNSgMVNPSRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 110
                         89*****************99*************************************995 PP

2Wus_type_Homeobox112.32.6e-3649111264
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  WALNUT_00010089-RA  49 PKPRWNPKPEQIRILEAIFNSGMVNPSRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 111
                         689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-735109IPR009057Homeodomain-like
PROSITE profilePS5007111.01346111IPR001356Homeobox domain
SuperFamilySSF466892.48E-1247114IPR009057Homeodomain-like
SMARTSM003894.5E-1048115IPR001356Homeobox domain
CDDcd000861.38E-949111No hitNo description
PfamPF000462.9E-1650110IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQWQHDINSC DRGPNTSVPG CEQERSPEPK PRWNPKPEQI  60
RILEAIFNSG MVNPSRDEIR KIRAQLQEYG QVGDANVFYW FQNRKSRSKH KLRHLQNSKN  120
QSQHTQNNLP INSLAAAINA PSSSSFSSEK SSPKAPQMMT TSKRAFPNVT DASNSPTASV  180
NHTFFQSRGE NLPEPFFFPV QQITGDQVHH NVGTASFTQG FCFPELSNAV QVPGHDTVGP  240
CTSLLISEIM NHGDSEKSLE DEKAMKFFHH QQNYAVTTHP ITHTTAVSPS TTATNYTGTV  300
SSPIDQVQGV GESGAVGTGG PAKSTVFINE VAFEVATGPF NVREAFGDDA VLIHSSGQPL  360
ITNEWGVTLQ PLLDGAFYYL VRAFDFN
Functional Description ? help Back to Top
Source Description
UniProtHomeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018833531.10.0PREDICTED: WUSCHEL-related homeobox 9-like
SwissprotQ6X7J43e-86WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A2I4FPE80.0A0A2I4FPE8_JUGRE; WUSCHEL-related homeobox 9-like
STRINGEOY281171e-166(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-87homeobox-3
Publications ? help Back to Top
  1. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  3. Raines T, et al.
    The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
    Plant J., 2016. 85(1): p. 134-47
    [PMID:26662515]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]