PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00009483-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GATA
Protein Properties Length: 382aa    MW: 41890.9 Da    PI: 6.068
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00009483-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18295329135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  WALNUT_00009483-RA 295 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 329
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.7E-16289343IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.517289325IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.8E-14289351No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14293327IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.23E-14294342No hitNo description
PfamPF003202.3E-16295329IPR000679Zinc finger, GATA-type
PROSITE patternPS003440295320IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MLSRTPHPLF SQFHHTFSCS IPPTSATSTI TSVPFLKYPC IQAETEMECV EAALKTSSRK  60
EMTVKSTPQL VFQDLSPGNG QNGVGCDDFF VDELLDLSNE DGFVKEEPAE EEEEQEEEDK  120
GFVSVSHQQD HQNSNTKITL SAKDEFGSEL SVPTDDLANL EWLFVEDSFP EFCTPYPAGS  180
LTEKPKNEGP EPELVKPCFK TPVPAKARSK RTRTGGRVWS LSSPSLTESS SSSTSSTSSS  240
SPSSTWLIYP TAAQKAGLVE TVYSVEKPPA KRQKKKPTPG EPALVSFGAQ LPRRCSHCGV  300
QKTPQWRTGP LGAKTLCNAC GVRFKSGRLL PEYRPACSPT FSSELHSNHH RKVLEMRRKK  360
ESPGVTQSDL AAPAVSSFLE EL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241780.11e-132PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH572e-79GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-129M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-77GATA transcription factor 5