PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00009123-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 388aa    MW: 44173.8 Da    PI: 7.1606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00009123-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.31.1e-3063116255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH rF++ave +GG+e+AtPk +l++m++kgL+++hvkSHLQ+YR+
  WALNUT_00009123-RA  63 PRLRWTPDLHLRFIHAVEIMGGQERATPKMVLQMMNIKGLSIAHVKSHLQMYRS 116
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-2759117IPR009057Homeodomain-like
PROSITE profilePS5129412.80159119IPR017930Myb domain
SuperFamilySSF466898.06E-1462117IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2163118IPR006447Myb domain, plants
PfamPF002493.2E-864115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGESDVSECS KRSPSDQIED GSCESGENDD ECEPINGGSS SNSTVEESEK KTSVRPYARS  60
KLPRLRWTPD LHLRFIHAVE IMGGQERATP KMVLQMMNIK GLSIAHVKSH LQMYRSKKVH  120
DPDQVLAEPR HHHVESGDRN IFKLSQLPMF QGYNPGHISN YRFGDASSWS TAYENLLGFT  180
AGRRSMNNIS STTRFYEKVG ERILGSSYSN YWTDCMMNFR PGNSTFCKQP TAWRTQELRD  240
GVHKHDSSLQ TRARISSTRS DLKPVTHLQA EIQQEHTSSC NDNAISDFSK TTNVKEWNST  300
LKRKASECEQ LDLDLSLRLT SSGNDDYHHE NQRSSRDSKV EISDLSLCLY SSQSSSSHQI  360
LKERRDHAGK EQERRRACTH DHDLDLTI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-61G2-like family protein