PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00008423-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 206aa    MW: 23981.8 Da    PI: 6.6285
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00008423-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53.1e-20666257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++R+++t+eq+ +Lee++++  r+p+ +++++++++l    +++ ++V++WFqN++a++++
  WALNUT_00008423-RA  6 SPRWCPTPEQIMILEEMYRSgIRTPNSSQIQKITAHLsfygKIEGKNVFYWFQNHKARDRQ 66
                        58*****************99*************************************996 PP

2Wus_type_Homeobox121.73e-39567264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +++RW+PtpeQi+iLee+y+sG+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
  WALNUT_00008423-RA  5 TSPRWCPTPEQIMILEEMYRSGIRTPNSSQIQKITAHLSFYGKIEGKNVFYWFQNHKARDRQK 67
                        679***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.074267IPR001356Homeobox domain
SMARTSM003899.9E-5471IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-7766IPR009057Homeodomain-like
CDDcd000861.06E-4767No hitNo description
SuperFamilySSF466893.38E-11766IPR009057Homeodomain-like
PfamPF000466.6E-18766IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MPPATSPRWC PTPEQIMILE EMYRSGIRTP NSSQIQKITA HLSFYGKIEG KNVFYWFQNH  60
KARDRQKLRR KLSKQLQQQQ LHYYNHEQLN QQNQLFLGYP DNHDQFHGSS ALQQLSHENS  120
VSFLPQGGSR DVGSASTQAT QDITWKQVDI PDDQMGEIDN SKMTTYDYDW NKEIMVEMDP  180
IFSPRCPTSL QTLQLFPVTA TNLKED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018860214.11e-155PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLA0A2I4HVP21e-154A0A2I4HVP2_JUGRE; WUSCHEL-related homeobox 3-like
STRINGEOY342243e-61(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.16e-37WOX family protein