PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00007917-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family Nin-like
Protein Properties Length: 309aa    MW: 35886.4 Da    PI: 4.7325
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00007917-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.93.1e-26144191552
              RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  WALNUT_00007917-RA 144 LSRKTISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 191
                         7899*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.087125211IPR003035RWP-RK domain
PfamPF020428.3E-22144191IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGSQTLNGLW PKHEIGYRDD DPYLFPSQMA SLDLSWYSPM DWQYELPIQE SFMDAIPLME  60
SYPTENLFAS LDLEPAISVM QDDVFCCYGS WHGVCNETGP KLDPENQANL LLRNNDKKGN  120
NGPREDQGKM KRYREERSSS SRLLSRKTIS QYFYMPITQA AKELNVGLTL LKKRCRELGI  180
RRWPHRKLMS LQTLINNVQV LGKEEGEESE AKLREAIEIL EREKKLLEEI PDMQLENNTK  240
RLRQACFKAN YKKRKLGGMM MDSQSSSSSS NRGSADGYNM ANYERRNEEE EEEEEEVDEI  300
SLFLADFFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282066.11e-94PREDICTED: protein RKD1
TrEMBLA0A061FXS11e-93A0A061FXS1_THECC; RWP-RK domain-containing protein, putative
STRINGVIT_17s0000g06250.t011e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-43RWP-RK domain-containing protein