PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00007707-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family Trihelix
Protein Properties Length: 284aa    MW: 33904.3 Da    PI: 8.8153
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00007707-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix74.91.4e-2339121186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ +e+++ + +r e+++++ ++k++k lWe ++ km+e+g++rs++qCk+kw+nl +ryk +++ e +   + ++++p++++++
  WALNUT_00007707-RA  39 QWSIHETKEFLIIRAELDQTFMETKRNKLLWEVIATKMKEKGYNRSAEQCKCKWKNLVTRYKGCETKEAE---PMRQQFPFYNEVQ 121
                         7*******************************************************************98...456689***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.83E-2438103No hitNo description
PfamPF138379.2E-2039123No hitNo description
PROSITE profilePS500907.1554096IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEEHHLHPRS HHLHQQHQHQ HQQQHHISVN IDASDRFPQW SIHETKEFLI IRAELDQTFM  60
ETKRNKLLWE VIATKMKEKG YNRSAEQCKC KWKNLVTRYK GCETKEAEPM RQQFPFYNEV  120
QAIFAGRMQR MLWAEAEVGA SGSKKKAAHL SSDEEVDNED SEGEKAGSSR KKKKKGKSNI  180
NIGSSSGGIS GNIKDLREIL DDFMKQQMQM EAQWREAFDA RENERRLKEM EWRQTMEALE  240
SERIMMEQRW REREEQRRMR EEARAEKRDV LITALLNKLR REDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308224.11e-120hypothetical protein POPTR_0006s10240g
SwissprotQ9SDW01e-72TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9HCX71e-120B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-55Trihelix family protein