PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00007612-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MIKC_MADS
Protein Properties Length: 217aa    MW: 25291.6 Da    PI: 6.2374
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00007612-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.11.8e-261059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        rien++ rqvtfskRr g+lKK +ELSvLCda++ +iifsstgk+  y++
  WALNUT_00007612-RA 10 RIENQTTRQVTFSKRRSGLLKKTHELSVLCDAQIGLIIFSSTGKMCQYCT 59
                        8**********************************************986 PP

2K-box553.6e-19811581087
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                         e+   e+ + e++ L++e++ Lq    ++ Ged++sL++++L qLeq+Le+s++kiR++K+++l ++ + + +  +e+
  WALNUT_00007612-RA  81 EHDAREQIYAEISMLRAETHRLQLGMQRYTGEDMSSLTYEDLDQLEQELEHSINKIRDRKERMLEDENSSMYHWIQEN 158
                         455678899**************999****************************************999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.997161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-30277IPR002100Transcription factor, MADS-box
CDDcd002651.18E-40276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1781151IPR002487Transcription factor, K-box
PROSITE profilePS5129711.24885172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGRGKIPIRR IENQTTRQVT FSKRRSGLLK KTHELSVLCD AQIGLIIFSS TGKMCQYCTE  60
PLRMEEIIER YQKVTGTCVP EHDAREQIYA EISMLRAETH RLQLGMQRYT GEDMSSLTYE  120
DLDQLEQELE HSINKIRDRK ERMLEDENSS MYHWIQENRA AIEYQQAAME GKTVEHQQVG  180
DHFSLYGDQP SSVLQLATIP PHIQPYHLQL AQPNLRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-19171169MEF2C
5f28_B8e-19171169MEF2C
5f28_C8e-19171169MEF2C
5f28_D8e-19171169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018817273.11e-158PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1
SwissprotQ9ATE56e-74FBP24_PETHY; MADS-box protein FBP24
TrEMBLA0A2I4ED001e-157A0A2I4ED00_JUGRE; protein TRANSPARENT TESTA 16-like isoform X1
STRINGEOX990961e-118(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49352952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.37e-74MIKC_MADS family protein
Publications ? help Back to Top
  1. Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG
    In vivo imaging of MADS-box transcription factor interactions.
    J. Exp. Bot., 2006. 57(1): p. 33-42
    [PMID:16291798]