PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00005208-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 307aa    MW: 34350.2 Da    PI: 8.301
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00005208-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19137191256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q ++Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  WALNUT_00005208-RA 137 RKKLRLSKDQSNILEESFKEHNTLNPKQKQALAKQLGLRPRQVEVWFQNRRARTK 191
                         788899***********************************************98 PP

2HD-ZIP_I/II129.41.4e-41137226191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  WALNUT_00005208-RA 137 RKKLRLSKDQSNILEESFKEHNTLNPKQKQALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 226
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.4E-341108IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.609.9E-19110194IPR009057Homeodomain-like
SuperFamilySSF466899.19E-19128194IPR009057Homeodomain-like
PROSITE profilePS5007117.734133193IPR001356Homeobox domain
SMARTSM003896.9E-17135197IPR001356Homeobox domain
PfamPF000465.7E-17137191IPR001356Homeobox domain
CDDcd000861.76E-15137194No hitNo description
PRINTSPR000311.0E-5164173IPR000047Helix-turn-helix motif
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5173189IPR000047Helix-turn-helix motif
SMARTSM003402.6E-27193236IPR003106Leucine zipper, homeobox-associated
PfamPF021833.2E-11193227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVEKEDLGLS LSLSFPQNHH SLPLNLRPSL APSSAAASPS GFNHSKPSWN EAFSSSDRNS  60
ETFRAETRSF LRGIDVNRLP STGDCEEEAG VSSPNSTISS LSGKRSASER EANGEEHDLE  120
RDCSRGISDE EDGETSRKKL RLSKDQSNIL EESFKEHNTL NPKQKQALAK QLGLRPRQVE  180
VWFQNRRART KLKQTEVDCE FLKRCCETLT EENRRLQKEV QELRALKLSP QFYMQMTPPT  240
TLTMCPSCER VAVPVSSSSS AGDSTHARPQ QMGREGRRVP INPWATQTTR GPGVAHRTFD  300
AVLQPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135141SRKKLRL
2185193RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018825158.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-109HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A2I4F0I20.0A0A2I4F0I2_JUGRE; homeobox-leucine zipper protein HAT4-like
STRINGPOPTR_0003s07760.21e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-109homeobox protein 2
Publications ? help Back to Top
  1. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  4. Müller-Moulé P, et al.
    YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance.
    PeerJ, 2016. 4: p. e2574
    [PMID:27761349]
  5. Ivarson E, et al.
    Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre.
    Front Plant Sci, 2016. 7: p. 2032
    [PMID:28119714]
  6. Kasulin L, et al.
    A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina.
    Mol. Ecol., 2017. 26(13): p. 3389-3404
    [PMID:28316114]
  7. Singh M,Gupta A,Singh D,Khurana JP,Laxmi A
    Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth.
    Sci Rep, 2017. 7(1): p. 16101
    [PMID:29170398]