PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004405-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28728.7 Da    PI: 9.6076
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004405-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.87.8e-30957149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +rienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gkl+ +
  WALNUT_00004405-RA  9 ERIENKINRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSSRGKLFQF 57
                        69********************************************999 PP

2K-box96.63.7e-32761715100
               K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                         +++++ e+ +++l++e+++L++++e+Lqr+qRh+lGedLe+L+lkeLq+Le+qL+k l++ R++K++++l+ +eel++ke+ l e nk+L+
  WALNUT_00004405-RA  76 QDTDVVEQGTQTLYREITRLRAKYESLQRSQRHMLGEDLEPLNLKELQNLEKQLDKTLSRARQRKTQIMLDRLEELRQKERCLGEMNKQLK 166
                         677899999********************************************************************************** PP

               K-box  96 kklee 100
                         +k+ee
  WALNUT_00004405-RA 167 SKIEE 171
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.385161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-33286IPR002100Transcription factor, MADS-box
CDDcd002651.91E-43276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.65585175IPR002487Transcription factor, K-box
PfamPF014869.8E-2885169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVVLER IENKINRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSS RGKLFQFGST  60
EMNKILERYR QCCYSQDTDV VEQGTQTLYR EITRLRAKYE SLQRSQRHML GEDLEPLNLK  120
ELQNLEKQLD KTLSRARQRK TQIMLDRLEE LRQKERCLGE MNKQLKSKIE EKGQRVHEAI  180
QGPGNPTTQA PVDCFEQLHT SHTNHAALER PTFHSGYHQS AVLDPQEAAM ETRTFTGGTS  240
RYQAWFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-24182186MEF2 CHIMERA
6byy_B2e-24182186MEF2 CHIMERA
6byy_C2e-24182186MEF2 CHIMERA
6byy_D2e-24182186MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018830769.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
SwissprotQ8LLR11e-93MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBLA0A2I4FGK20.0A0A2I4FGK2_JUGRE; truncated transcription factor CAULIFLOWER A-like isoform X1
STRINGXP_010272608.12e-94(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22932178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-74AGAMOUS-like 6
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]