PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004372-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 763aa    MW: 83547.3 Da    PI: 7.1982
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004372-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.6e-19130187156
                         TT--SS--HHHHHHHHHH.HHH.SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeel.Fek.nrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++k +++t++q++eLe++ F   +++p++++r eL+++lgL+++qVk+WFqNrR+++k
  WALNUT_00004372-RA 130 KKKYHRHTPHQIQELEAYdFSYeCPHPDEKQRLELSRRLGLETKQVKFWFQNRRTQMK 187
                         79999************889866********************************999 PP

2START141.39.4e-4532248060205
                         HHHHHHCCCGG..CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS-- CS
               START  60 llveellddke..qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkpp 137
                         + ++ l+      +W+ +++    +a+t++ is+g      galq+m aelq+lsplv+ R   f+R+++q+ +g+w++vdvS+d  q+ +
  WALNUT_00004372-RA 322 KPPMGLMGNEVpgRWKDMFPcmvaRAATIDWISTGsagirnGALQVMHAELQVLSPLVSvRQLKFLRFCKQQAEGVWAVVDVSLDISQEGT 412
                         555555555446799999999999******************************************************************* PP

                         .-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 138 esssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         + +++v +++lpSg+++++++ng+skvtwveh +++++ +h+l+rs+++ g+ +ga++wvatlqr ce
  WALNUT_00004372-RA 413 NVQPFVNCRKLPSGFVVQDLPNGYSKVTWVEHSEYDESCIHQLYRSFISAGMGFGAQRWVATLQRRCE 480
                         *****************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-20112187IPR009057Homeodomain-like
SuperFamilySSF466892.92E-17116189IPR009057Homeodomain-like
PROSITE profilePS5007115.386127189IPR001356Homeobox domain
SMARTSM003892.6E-13129193IPR001356Homeobox domain
CDDcd000868.18E-17130189No hitNo description
PfamPF000462.8E-16130187IPR001356Homeobox domain
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
SMARTSM002341.1E-25252481IPR002913START domain
PROSITE profilePS5084829.553327484IPR002913START domain
CDDcd088757.97E-78333480No hitNo description
PfamPF018524.1E-39333480IPR002913START domain
SuperFamilySSF559611.13E-22334480No hitNo description
Gene3DG3DSA:3.30.530.202.9E-5362464IPR023393START-like domain
SuperFamilySSF559611.0E-19516730No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MHEERQKHRG FIFSFFFFVM GLGGLISGAS GGSSGGGVAR VVADIAPHRI AQPPLPTPIP  60
RSKHSSSTHT LSIPRKMEGH GEMGLIGEKI DTGLMVRMRD DEYESRSGSD NVEGASGDDL  120
DAGDDQRPKK KKYHRHTPHQ IQELEAYDFS YECPHPDEKQ RLELSRRLGL ETKQVKFWFQ  180
NRRTQMKTQL ERHENLMLKQ DNDKLKAEND IMRGAMANPI CNNCGGPAIP GQISFEEHQL  240
RIDNARLKDE LNRICALANK FLGRPLSSLP APMLLSSSNS GLELAVGRNG IGGLSSIGTS  300
LHMGLDLGDG VLSTSSAMPL IKPPMGLMGN EVPGRWKDMF PCMVARAATI DWISTGSAGI  360
RNGALQVMHA ELQVLSPLVS VRQLKFLRFC KQQAEGVWAV VDVSLDISQE GTNVQPFVNC  420
RKLPSGFVVQ DLPNGYSKVT WVEHSEYDES CIHQLYRSFI SAGMGFGAQR WVATLQRRCE  480
FLAILMSSSI PNEDQTVWLH ILIHTMRSSA VISSAGRSSM LKLAQRMTDN FCSGVCASTA  540
RNWDNLHVGN VGEDVRVMTR KNLDDPGEPP GIVLSAATSV WIPVAQPRLF DFLRDDRLRS  600
EWDILSTGRP IQEMVHIAKG HKQGNCVSLL RGSPTNANEN NMLILQETWS DASGSVVVYA  660
PVDIPSINVV MGGGDSAYVA LLPSGFAILP DEPSSYGGPH NFNRTMVKAG DNGTDGGGCL  720
LTVGFQILLD SQPTAKLTVE SVETVNNLIS CTIQKIKAAL KVT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-GCATTAAATGC-3'. {ECO:0000269|PubMed:16778018}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027363224.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X3
SwissprotQ9LTK30.0HDG7_ARATH; Homeobox-leucine zipper protein HDG7
TrEMBLA0A2H5NMS90.0A0A2H5NMS9_CITUN; Uncharacterized protein
STRINGXP_006490345.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-167HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]