PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003889-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 315aa    MW: 35403.1 Da    PI: 10.0164
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003889-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind354.42.4e-10813151301
           GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernka 73 
                         mdd  ++e  r+k  yy+              ++ ++l   +++++ms+i+erda+i+ern+a+sek++a+a+rd+a++qrd+ala+r+ a
  WALNUT_00003889-RA   1 MDDGRKHEngRHKMdYYReshspwnmvpqhqlKEpNALV--MNKKIMSIISERDAAIHERNAAISEKNEALAARDEALHQRDEALAQRDSA 89 
                         666655555899988998999999999765552234555..99************************************************ PP

           GAGA_bind  74 lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekka 164
                         l+erdn+++al++++n++  + p g ++ +gtk +++l + +  +l++ +++++e ++++a+pi+  a+ea ++++ k+++ +k+  +k++
  WALNUT_00003889-RA  90 LMERDNAFAALQVRDNTM--NFPLGGGIQRGTKRMHHLSN-HPDNLAEAPYNTKEAQITNAFPITVIASEAVRSHQAKRTKDNKSVCSKQS 177
                         **************9985..56889999********9988.669********************999999999888887777777666666 PP

           GAGA_bind 165 kkkkk...ksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrg 252
                         k++++    +e+ +++  ++s+ ++ ++e++ +d++ln v +Dest+P PvCsCtG+lrqCYkWGnGGWqS+CCtt +S+yPLP+++++r+
  WALNUT_00003889-RA 178 KSPRNgkkLGEDLNRQ--AASVGTKYRSEWDGQDVGLNLVIFDESTMPLPVCSCTGVLRQCYKWGNGGWQSSCCTTRMSMYPLPQMPNKRH 266
                         6555400033333333..3333489****************************************************************** PP

           GAGA_bind 253 aRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         aR++grKmS+++f++lL+++aa G+dls p+DLkd WA+HGtn+++ti+
  WALNUT_00003889-RA 267 ARVGGRKMSGSVFTRLLSRVAAAGHDLSLPLDLKDSWARHGTNRYITIK 315
                         ************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.4E-1411315IPR010409GAGA-binding transcriptional activator
PfamPF062172.2E-971315IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDDGRKHENG RHKMDYYRES HSPWNMVPQH QLKEPNALVM NKKIMSIISE RDAAIHERNA  60
AISEKNEALA ARDEALHQRD EALAQRDSAL MERDNAFAAL QVRDNTMNFP LGGGIQRGTK  120
RMHHLSNHPD NLAEAPYNTK EAQITNAFPI TVIASEAVRS HQAKRTKDNK SVCSKQSKSP  180
RNGKKLGEDL NRQAASVGTK YRSEWDGQDV GLNLVIFDES TMPLPVCSCT GVLRQCYKWG  240
NGGWQSSCCT TRMSMYPLPQ MPNKRHARVG GRKMSGSVFT RLLSRVAAAG HDLSLPLDLK  300
DSWARHGTNR YITIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018841398.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841399.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841400.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841401.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841402.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841403.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_018841404.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-133BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A2I4GBW90.0A0A2I4GBW9_JUGRE; protein BASIC PENTACYSTEINE4-like
STRINGXP_004148546.10.0(Cucumis sativus)
STRINGXP_004172323.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-135basic pentacysteine 4