PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003876-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GATA
Protein Properties Length: 336aa    MW: 36979.1 Da    PI: 5.2947
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003876-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.59.2e-19254287134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  WALNUT_00003876-RA 254 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 287
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-8212334IPR016679Transcription factor, GATA, plant
SMARTSM004014.9E-14248302IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-13251311No hitNo description
PROSITE profilePS5011411.174252284IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-14252285IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.42E-14253310No hitNo description
PfamPF003201.8E-16254287IPR000679Zinc finger, GATA-type
PROSITE patternPS003440254279IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MEMEQCVEER AFKSSLRGEL PEKSTQQALS LDDYCCAIGV PGEDFFVDDL LDLSNAEFED  60
GNVVGQEEEQ LVKDSLSGSS SQEQVDDDSS NSTHFSGTAE SESHLASELA VPDDDLAELE  120
WVSHFVDDSP SDFSLSYVAG TQKAETLTTN RSEQPESRPR PSSTRPPCFS SAVPSKTRTK  180
RTRTSNRVWT LGSGLTESTP PSSASSPGFS SIPCLIFTNT FQNMELFALA EPSTKKQKKK  240
PRVLTGGTLF QRRCSHCQVQ KTPQWRTGPL GPKTLCNACG VRFKSGRLFP EYRPACSPTF  300
SGNIHSNSHR KVLEIRKRKE MVTEPGSGLT QMVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236855.11e-119PREDICTED: GATA transcription factor 5-like
RefseqXP_008236856.11e-119PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ01e-111D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0009s12620.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-49GATA transcription factor 5