PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003687-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SBP
Protein Properties Length: 629aa    MW: 70482.8 Da    PI: 6.9899
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003687-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.8e-41247323278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         Cqv gC++dl++ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q+
  WALNUT_00003687-RA 247 CQVYGCHKDLNSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQM 323
                         **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-33241308IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.411244321IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-38245325IPR004333Transcription factor, SBP-box
PfamPF031102.5E-31247320IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MWVVCGAYQD YPMVNRSWCL YALVEFEVKI QLGLWVKVPY KKVIFFPIVL NCSGFLRSRE  60
TVILLHEMEP WNYVSEGKGF ESDERISPNN SLSRNKNALF GWQLRTPCSF GNNMLVSGGQ  120
QAVENQGFGE LGFPEIVGKQ LADNSMSEVL SGQFGGGRFV NPIMAIPNAF SAEDHHEYTS  180
PKLSTSMVDS NSRVSSLFDL NLGRLPDQQD AQNSKFPKGV PILSSFESST TAKRVRTSGL  240
NSQSAFCQVY GCHKDLNSSK DYHKRHKVCE VHSKTAKVIV NGIEQRFCQQ CSRFHLLAEF  300
DEGKRSCRKR LAGHNERRRK PQMSIHDSGR AGRSLLRSFD GSDQGYQVGT TSFICQEILP  360
SGLLHPEKYE TSEWGRHVKV EDGTDYRHLS TFPVTNGHLH SNSLFPQDIE KQYFHPFQDN  420
GTRTATGNFF MEYSDQYIHD IGGGPTPSSH SIFHNTSLGS EEYNVFDAAT TVEGLPRVPD  480
PSGYALSLLS SQSQNSSSQR PAGIPMVRPL IMPSNHSHYG MGRFTEKLIG IRSQHSSGGV  540
SNKLPLSEMN SAEENDHHLG PILISNTGDA VNLDGIFQEF DIWNPNDRHS CDQNGPDLLQ  600
LSSQLERVEH QRQSLQVKRE NDSSCLRIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29237320584squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018838995.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_018839003.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_018839011.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_018839021.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_018839029.10.0PREDICTED: squamosa promoter-binding-like protein 18
TrEMBLA0A2I4G5230.0A0A2I4G523_JUGRE; squamosa promoter-binding-like protein 18
STRINGEOY221290.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-45SBP family protein