PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003295-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 249aa    MW: 27927.3 Da    PI: 8.2152
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003295-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-1879133256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq  +Lee F+++++++ +++  LA++l+L+ rqV vWFqNrRa+ k
  WALNUT_00003295-RA  79 RKKLRLSKEQSLVLEETFKEHNTLNPKQKLALARQLNLSPRQVEVWFQNRRARTK 133
                         788899***********************************************98 PP

2HD-ZIP_I/II125.82e-4079168191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+ +LEe+F+e+++L+p++K +lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+een+rL+kev+eLr +l
  WALNUT_00003295-RA  79 RKKLRLSKEQSLVLEETFKEHNTLNPKQKLALARQLNLSPRQVEVWFQNRRARTKLKQTEVDCEYMKRCCENLTEENRRLQKEVQELR-AL 168
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.0E-17248IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.5E-1962134IPR009057Homeodomain-like
SuperFamilySSF466895.85E-2066136IPR009057Homeodomain-like
PROSITE profilePS5007117.31375135IPR001356Homeobox domain
SMARTSM003891.1E-1677139IPR001356Homeobox domain
PfamPF000463.4E-1679133IPR001356Homeobox domain
CDDcd000861.04E-1679136No hitNo description
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PfamPF021835.2E-11135169IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.6E-26135178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDRNPDTRSF LGGVDVNRLP SMVDCEDENG VSSPNSTVSS ISGKRGERSE PNGEENEAER  60
TSCSRGSDEE DGSGCDTSRK KLRLSKEQSL VLEETFKEHN TLNPKQKLAL ARQLNLSPRQ  120
VEVWFQNRRA RTKLKQTEVD CEYMKRCCEN LTEENRRLQK EVQELRALKL SPQLYMHMNP  180
PTTLTMCPSC ERVAVSSSSS TPPSSSTVAA PVGPNRHRVA PHVQRPVPIY PWATLPIHNR  240
PSDVPASRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17783SRKKLRL
2127135RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889483.11e-126PREDICTED: homeobox-leucine zipper protein HAT3
SwissprotP466021e-102HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A067HCG81e-124A0A067HCG8_CITSI; Uncharacterized protein
TrEMBLV4U8Y01e-124V4U8Y0_9R
STRINGPOPTR_0014s04460.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-92homeobox-leucine zipper protein 3