PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003165-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 360aa    MW: 41092.1 Da    PI: 9.7976
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003165-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2088147357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eql +Le+l+++ +r+p+ae++ ++A+ l    +++ ++V++WFqN++a+e++
  WALNUT_00003165-RA  88 TRWNPTSEQLLALEDLYRRgTRTPTAEQIHQIAAYLrrfgKIEGKNVFYWFQNHKARERQ 147
                         8*****************99**************************************97 PP

2Wus_type_Homeobox108.83.1e-3587149365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +tRW+Pt+eQ+  Le+ly++G+rtP++e+i++i+a L+++Gkie+kNVfyWFQN+kaRerqk+
  WALNUT_00003165-RA  87 TTRWNPTSEQLLALEDLYRRGTRTPTAEQIHQIAAYLRRFGKIEGKNVFYWFQNHKARERQKR 149
                         79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-1384155IPR009057Homeodomain-like
SMARTSM003892.6E-485152IPR001356Homeobox domain
PfamPF000463.6E-1888147IPR001356Homeobox domain
CDDcd000863.40E-588149No hitNo description
Gene3DG3DSA:1.10.10.601.5E-888147IPR009057Homeodomain-like
PROSITE profilePS5007111.12793148IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MWTMGSHGDG REITNLSDPV SGFKLRPLIP KPTSVIPRNS IISPILAPPY RDCSTHFTTS  60
LYSLNHQPGR YVTEQFRTNF NPQPLVTTRW NPTSEQLLAL EDLYRRGTRT PTAEQIHQIA  120
AYLRRFGKIE GKNVFYWFQN HKARERQKRR REMASHLPEQ QRGSSSPAEK ESAVTRRTVY  180
KVRQEKKWAP LLNCSELKEE SATSMNKAAI AAERFTHGWC VQFGERESQQ QRRSTGDRRG  240
GTWQSTETPC SPPIKTLPRT ATLSDTTNLL DSHYFMSMTP DKEDVPHLGD QIRSCESKTL  300
NLFPLPGNDN SDGNDHVSRT NTKVPITSRP DDSFASNQFF EFLPLKIRGK QPADPSCDQN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018842699.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A2I4GFL90.0A0A2I4GFL9_JUGRE; WUSCHEL-related homeobox 1-like
STRINGVIT_01s0011g05020.t017e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.18e-39WUSCHEL related homeobox 1