PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003143-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family Nin-like
Protein Properties Length: 248aa    MW: 29052.3 Da    PI: 6.5229
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003143-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.73e-25140188452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++l++++k+F+ pi++AAk+++v+lTvLK++CR+++IkRWPhRk+ksl
  WALNUT_00003143-RA 140 VLELDEIQKHFDIPITKAAKKMNVGLTVLKKRCRELNIKRWPHRKLKSL 188
                         5899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.075121210IPR003035RWP-RK domain
PfamPF020423.2E-22141188IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MMPVLENIPK MEINPHEFNW YYPEECSDRI LELPPLDCYF ELDPLPFPHG NKQLYITEFK  60
NFEALNPDFF SAEPDFPLFY EDVAVDQSPL NSVTDSIGQF ENLATYLSEY STIIHQGEYQ  120
SSNNTEEEKR TISGRKKMAV LELDEIQKHF DIPITKAAKK MNVGLTVLKK RCRELNIKRW  180
PHRKLKSLTS LINNVKELGL TKEIETLEEH KKILEKLPDA ELTERTRKLR QACFKANYKK  240
RRSLAIQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039079.19e-79RWP-RK domain-containing protein, putative
TrEMBLA0A061G1541e-78A0A061G154_THECC; RWP-RK domain-containing protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-46RWP-RK domain-containing protein