PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00003114-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 244aa    MW: 27576.5 Da    PI: 6.7902
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00003114-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-193991456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        + +f++eq++ Le+ Fe++  +  +++ +LA++lgL+ rqV +WFqNrRa++k
  WALNUT_00003114-RA 39 KKRFSDEQIKSLESIFESDTRLEPRKKVQLARELGLQPRQVAIWFQNRRARWK 91
                        467*************************************************9 PP

2HD-ZIP_I/II120.68.3e-3938129293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+r+s+eq+k+LE+ Fe++++Lep++Kv+lareLglqprqva+WFqnrRAR+k+k +E++y++L+++y++l+++ e+L+ke+++L  +l+
  WALNUT_00003114-RA  38 NKKRFSDEQIKSLESIFESDTRLEPRKKVQLARELGLQPRQVAIWFQNRRARWKSKYIEQEYRTLRDNYENLASQFESLKKEKQSLLIQLQ 128
                         69************************************************************************************99987 PP

         HD-ZIP_I/II  93 e 93 
                         +
  WALNUT_00003114-RA 129 N 129
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.4E-162797IPR001356Homeobox domain
CDDcd000862.73E-162893No hitNo description
SuperFamilySSF466892.49E-183092IPR009057Homeodomain-like
PROSITE profilePS5007117.7673393IPR001356Homeobox domain
PfamPF000465.1E-173991IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-194099IPR009057Homeodomain-like
PRINTSPR000314.7E-66473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000314.7E-67389IPR000047Helix-turn-helix motif
PfamPF021831.8E-1295134IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEGRECKSYT PAVPEGRHDD QNLTCQQPRK RTNKKIMNKK RFSDEQIKSL ESIFESDTRL  60
EPRKKVQLAR ELGLQPRQVA IWFQNRRARW KSKYIEQEYR TLRDNYENLA SQFESLKKEK  120
QSLLIQLQNL GDLLGENHDG NGESSSKGLE GNSTVAGRSD DGSSDSETKA KSSCLQKGME  180
HKGVMFPYEE ENGVGSFGGG GHGFLNMNEP HGPLASLDEG YSTYDSGGLL DHLCSSSYWL  240
NSWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018842791.10.0PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A2I4GFX10.0A0A2I4GFX1_JUGRE; homeobox-leucine zipper protein ATHB-12-like
STRINGXP_007136490.12e-66(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.24e-46homeobox 7