PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002780-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family ARR-B
Protein Properties Length: 713aa    MW: 78049 Da    PI: 5.7255
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002780-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like621.2e-19212255145
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                         kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+
  WALNUT_00002780-RA 212 KPRVVWSVELHRKFVAAVNQL-GLEKAVPKKILDLMNVEGLTREN 255
                         79*******************.********************987 PP

2Response_reg81.82.1e-27261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll ++l+k +y +v+++ ++  al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  WALNUT_00002780-RA  26 VLAVDDDPICLKLLDTLLRKCQY-QVTTTNQAVMALKMLRENKdkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTQLVMKG 114
                         799********************.***************888888*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  WALNUT_00002780-RA 115 VTHGACDYLLKPVRIEELKN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.0E-1581702IPR017053Response regulator B-type, plant
SuperFamilySSF521721.99E-3523147IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.0E-4323147No hitNo description
SMARTSM004481.3E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.38425140IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.7E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.54E-2927140No hitNo description
Gene3DG3DSA:1.10.10.603.3E-20209264IPR009057Homeodomain-like
SuperFamilySSF466891.2E-11210263IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-15212255IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MTVEDHKGGL AGEDVARDRF PLGMRVLAVD DDPICLKLLD TLLRKCQYQV TTTNQAVMAL  60
KMLRENKDKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTQL VMKGVTHGAC  120
DYLLKPVRIE ELKNIWQHVI RRKKFDSKDQ NKSLNEDRAL HGTEDGGRGF ISTGNADQDD  180
RLSRKRKEQN EDEEEDDEEN EHENDDASNQ KKPRVVWSVE LHRKFVAAVN QLGLEKAVPK  240
KILDLMNVEG LTRENKYRLY LKRINSVAAQ QASMVAALGG KDSSYLRMGS LDGFGEFRSL  300
AGSGRLSSSA LSSYTPGGMF GRLNSPAGLT LRGITSSGLV QPTGQNLSSS INTLGKFQSA  360
LLPSNQSASL FQGIPTSLEL NQLQQNKCTT RIRDFNPIKD SRGFTVTTSF SDSRVNVGSS  420
PSLLPGLSSN SLVLQGNPHQ AHNGGAFGSQ SSLGAASLTA DAFENCSGGS SNFLVHNQSN  480
ESWQGTVHSS RFSSNALPLN EPFNHDQLPS NNLSKSSTSP HIGNSSIDFP STSAVLAPLE  540
DSRGDVQCHE GVIGNVVHSM NYPSNQNWEE QKPDYNHNLN HTVSALNSLV PANGIVNPLS  600
QSLDQNTAIC SKSFDVSLIS QLHDGALSID QNSEVERYAL GTKMTPNEDY LFEQTRSLDG  660
FTQNSFGSLD DIMNTLMKRE QNQTMLCDGE FASDAYSLGS CISSVSRKSK KEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-18210265364ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018850345.10.0PREDICTED: two-component response regulator ARR12-like isoform X1
TrEMBLA0A2I4H2G00.0A0A2I4H2G0_JUGRE; two-component response regulator ARR12-like isoform X1
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-116response regulator 12