PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002455-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SBP
Protein Properties Length: 1047aa    MW: 116322 Da    PI: 8.101
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002455-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.81.8e-39144221178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C++dls+ak+yhrrhkvCe+hsk++++lv++++qrfCqqCsrfh ls fDe+krsCrrrL++hn+rrrk+q+
  WALNUT_00002455-RA 144 MCQVDNCKEDLSNAKDYHRRHKVCEAHSKSTKALVAKQMQRFCQQCSRFHLLSAFDEGKRSCRRRLDGHNRRRRKTQQ 221
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-33138206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.299142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-36143222IPR004333Transcription factor, SBP-box
PfamPF031102.2E-28145218IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.37E-5812935IPR020683Ankyrin repeat-containing domain
CDDcd002041.14E-4842938No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1047 aa     Download sequence    Send to blast
MEEAGPQVAS PIFIHPQTLQ SRFSMAKKRD LLNVQAKPPL MTPTTELQNH IMDDWNAKGW  60
DWDSVRFVAK PLDLRLGTPA TAAAAAEQKK KESSRSVSVE EEDESLRLNL GGGLKFVEEE  120
QEPQSRPNKR VRSGSPGTGG NYPMCQVDNC KEDLSNAKDY HRRHKVCEAH SKSTKALVAK  180
QMQRFCQQCS RFHLLSAFDE GKRSCRRRLD GHNRRRRKTQ QEDVTGRLLL PGNRDNTASN  240
ANLDVVNLLA AIARTQGKNE DKTINCSSIP DRDHLVQILS KINSLPLPPD LVAKLPNLGS  300
LHGKLPGHTS LEHQIKLNGN ACSPSTKDLL AVLSAPLATS APDALTILSQ KSSHSSDSEK  360
TKITHSDQTT LNLQKRPPLE FPSVGGERIS SGYQSPMEDS DGQVQEVHVN LPLQLFGSSP  420
EDDSPPKLAS SRKYFSSDSS NPIDGRSPSS SPPTVQKLLP IQRKRETLKP ENMTINKGLN  480
ANVVASRTGD SKRPFDLFRG SNTGAEPGSF QSFPYQAGYI SSGSDHSPPS LNSDAQDRTG  540
RIIFKLFDKD PSHFPETLRT QISCWLSNRP SEMESYIRPG CVVLSVYVSM PSAAWEQFEQ  600
NLLERVNTLV QSSDSDFWRS GRFIINTGRQ LASHKDGKIH LCKSWRTWSS PELILVSPLA  660
VVDGQETSLL LKGRNLSNPG AKIHCTYMGG YISKEVSEST CQGTSYDKIN LGNGFPVIVA  720
NSTICEELRL LESEFDLEAR EYDDISEENT NDFRRPKSRE EVLHFLNELG WLFQRIGNTS  780
MLGNPDYSLC RLKFLLTFSV ERDCCALVRK LLDILVERNF DGNVLTKESL ETLSEIQLLN  840
RAVKRRCRKM VDVLIHYSIT SSNDASKKYI FPPNVVGPGG VTPLHLAACT SGSDDLIDAL  900
TSDPLEIGLN CWTTLLDAIG QSPYDYAMMR HNHSYNKLVA RKLTDRENGQ VSVMVTSEIE  960
QARLSMEPEH QISTQVKQLR SCARCAVVAR KHNMRVSASQ GLLQRPFIHS MLAIAAVCVC  1020
VCLFLRGSPD IGSVAPFKWE NLGFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28134218184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1840845RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018832978.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2I4FMX40.0A0A2I4FMX4_JUGRE; squamosa promoter-binding-like protein 14
STRINGXP_008237887.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]