PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002171-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 330aa    MW: 35980.2 Da    PI: 5.3578
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002171-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.6e-29162215155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv++v +L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  WALNUT_00002171-RA 162 RPRLVWTPQLHKRFVDVVGHL-GIKSAVPKTIMQLMNVEGLTRENVASHLQKYRL 215
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-19159220IPR009057Homeodomain-like
PROSITE profilePS512949.503159218IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29161220IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-23163215IPR006447Myb domain, plants
PfamPF002494.8E-7165214IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGEEVKMTEY QGVALDQNGG HDDRVSEWES GLPGADDLTP LSQTLIPPEL ASAFSISPEP  60
YRTAIEVNRA SQTTLSTLRG QHSSKGFWSS DNFKSFDETR GGDPMVVEEA DETTDPDGSG  120
SGSGSEPRKS RRIDCAELEA DSALRAENSA DDPSSAARTL KRPRLVWTPQ LHKRFVDVVG  180
HLGIKSAVPK TIMQLMNVEG LTRENVASHL QKYRLYLKRM HGLSIEGPSS SEHQLFASTP  240
VPPQSLQEAA AGTALVHGNG HVPMPIPMPY PPPPMMPMPV LGVGHMGMSV GSHGFDSHNP  300
YNMMQQRDWS ENNNAYGSMV SYPYVVPNDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20161220463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283159.11e-138PREDICTED: transcription factor PCL1
RefseqXP_010650997.11e-138PREDICTED: transcription factor PCL1
RefseqXP_010650998.11e-138PREDICTED: transcription factor PCL1
SwissprotQ9SNB41e-86PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ01e-138F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-80G2-like family protein