PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001905-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 147aa    MW: 17348.7 Da    PI: 7.9697
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001905-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.41.2e-131669356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++ ++++eq++   + F +n+++  e++ +LA++l L+ rqV +W+qN+Ra++k
  WALNUT_00001905-RA 16 NKKRLNPEQVRLPDRSFTSNNKLEPERKLQLAEQLVLPLRQVAIWYQNKRARWK 69
                        56679999*********************************************9 PP

2HD-ZIP_I/II95.55.6e-3116107293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl+ eqv+l ++sF++++kLeperK +la++L l  rqva+W+qn+RAR+kt+ lE ++++L++++++   en+ Lek++e+L+ el+
  WALNUT_00001905-RA  16 NKKRLNPEQVRLPDRSFTSNNKLEPERKLQLAEQLVLPLRQVAIWYQNKRARWKTQSLELEHNVLHQELENALVENRWLEKDMERLKGELA 106
                         79*************************************************************************************9987 PP

         HD-ZIP_I/II  93 e 93 
                         +
  WALNUT_00001905-RA 107 K 107
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.3981171IPR001356Homeobox domain
SuperFamilySSF466895.13E-141382IPR009057Homeodomain-like
SMARTSM003893.9E-91375IPR001356Homeobox domain
CDDcd000863.50E-91472No hitNo description
PfamPF000463.9E-111669IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-141876IPR009057Homeodomain-like
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDFCCSQNQK HPSKHNKKRL NPEQVRLPDR SFTSNNKLEP ERKLQLAEQL VLPLRQVAIW  60
YQNKRARWKT QSLELEHNVL HQELENALVE NRWLEKDMER LKGELAKAQD MVLPLKQTGS  120
AQVSCTSINF DQDFYACLIG ENWSSWD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018822854.11e-84PREDICTED: homeobox-leucine zipper protein ATHB-52-like isoform X2
TrEMBLA0A2I4ETW53e-83A0A2I4ETW5_JUGRE; homeobox-leucine zipper protein ATHB-52-like isoform X2
STRINGXP_008226425.12e-47(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110112239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.13e-29homeobox protein 52