PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001748-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 712aa    MW: 78664.4 Da    PI: 6.5961
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001748-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53e-202277156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ +++t++q+++Le++F+++++p++++r  L+++lgL  rq+k+WFqNrR+++k
  WALNUT_00001748-RA 22 KKRYHRHTAHQIQRLEAMFKECPHPDEKQRSLLSRELGLAPRQIKFWFQNRRTQMK 77
                        688999***********************************************998 PP

2START172.52.7e-542194412206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a +a++el+++++ +ep+W+ks+    + +n +++ ++f+++++      +++ea r+sg+v+m+   lv  ++d+  +W e ++     
  WALNUT_00001748-RA 219 IAARAMEELLRLVQTNEPLWMKSAtdgrDVLNLETYERIFPRANTnlknphSRIEATRDSGLVIMNGLALVDMFMDSH-KWVELFPaivsL 308
                         6889**************************************999*********************************.*******99988 PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t+evissg      g lqlm+ +lq+lsplv+ R+f+f+Ry++q ++g w+ivdvS d +++++ s+    +++lpSg+li+ ++ng+s
  WALNUT_00001748-RA 309 GKTIEVISSGmlgshsGSLQLMYEDLQVLSPLVStREFYFLRYCQQIEQGLWAIVDVSYDFPREKQFSP---QCRRLPSGCLIQGMPNGYS 396
                         9***************************************************************98644...4556*************** PP

                         EEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv+ ++++p h l+r +v+ gla+ga +w+a l r ce+
  WALNUT_00001748-RA 397 KVTWVEHVEIEDKTPtHRLYRDVVHGGLAFGAERWLAILCRMCER 441
                         *****************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-22981IPR009057Homeodomain-like
SuperFamilySSF466897.94E-201582IPR009057Homeodomain-like
PROSITE profilePS5007117.2971979IPR001356Homeobox domain
SMARTSM003891.3E-192083IPR001356Homeobox domain
CDDcd000866.71E-192180No hitNo description
PfamPF000469.0E-182277IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084848.813209444IPR002913START domain
SuperFamilySSF559612.97E-34210442No hitNo description
CDDcd088752.94E-113213440No hitNo description
SMARTSM002344.9E-44218441IPR002913START domain
PfamPF018528.9E-47219441IPR002913START domain
Gene3DG3DSA:3.30.530.203.9E-6315411IPR023393START-like domain
SuperFamilySSF559612.97E-23465704No hitNo description
Gene3DG3DSA:3.30.530.200.001470551IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MEYGGGEGGE DRDASSDPQG RKKRYHRHTA HQIQRLEAMF KECPHPDEKQ RSLLSRELGL  60
APRQIKFWFQ NRRTQMKAQH ERADNCDLRA ENDKIRCENI AIREALRNVI CPSCGGPPVN  120
EDSYFDEQKL RIENAHLKEE LDRVSSIAAK YIGRPISQLP PVQPIHVSSL DLSMGSFEGQ  180
GVGGPSLDID LLPGSSSTVP SLPFQPRLSD MDRSLMTDIA ARAMEELLRL VQTNEPLWMK  240
SATDGRDVLN LETYERIFPR ANTNLKNPHS RIEATRDSGL VIMNGLALVD MFMDSHKWVE  300
LFPAIVSLGK TIEVISSGML GSHSGSLQLM YEDLQVLSPL VSTREFYFLR YCQQIEQGLW  360
AIVDVSYDFP REKQFSPQCR RLPSGCLIQG MPNGYSKVTW VEHVEIEDKT PTHRLYRDVV  420
HGGLAFGAER WLAILCRMCE RFACLMVTGT STTRDLGGVI PSTDGKRSMM KLAQRMVNNF  480
CASISTSNSH RWTTLSGMNE DGVRVSVHRS TDPGQPNGVI LSAATTIWLP VSPQNVFNFF  540
KDERTRAQWD VLSNGNGVQE VAHIANGSHP GNCISVLRAF NTSQNNMLIL QESCIDSSGA  600
LVVYCPVDLP AINIAMSGED PSYIPLLPSG FAISPDGRPD LLPADGASTS SSSQHGGTMM  660
SRFGGSLITV AFQILVSSLP SAKLNLESVT TVNNLIGSTV QQIKAALNCP GS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240378.10.0PREDICTED: homeobox-leucine zipper protein HDG11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLW9RIV50.0W9RIV5_9R
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11