PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001730-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 422aa    MW: 47307.7 Da    PI: 8.7095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001730-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.13.1e-31233286255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ ve LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  WALNUT_00001730-RA 233 PRMRWTSSLHSRFVHSVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 286
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-14230287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27231286IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-23233286IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MFRKDILEEP SNLHPIPDLS LHISPPKSAP SSICTAAHEG DLSFDVWRKD DHDKLKSHSD  60
NSIRASTQLA ETGFSLSNPK SALEAESQWR RNFISSNSTG GEEVLLQARH RNRGIPVPDV  120
PEGIKAIKGI PVFSTLDHSS KFCFNQMAAY PSFNASTRSS AAIRPYGIEG SEPISRYNGI  180
TMETLRTQQF HQYMQFPQHH YIGAAGASDF SNSFLRSSRF MPKLQSRKNM RAPRMRWTSS  240
LHSRFVHSVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKNT DRPAASSDGS  300
GDEDFLSTAP TLHDQNENCL LNQRRSSASN AVLEHEMGYH SNLWCNPSSR SGSWVQAASS  360
RNPDRLLRPE IYPSSQQRSG DQFDQVCDFA QSIKSRGSSL GLKNPSLEFT LGRPDWRSKE  420
HD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036993.11e-131Homeodomain-like superfamily protein, putative isoform 1
TrEMBLA0A061G3871e-131A0A061G387_THECC; Homeodomain-like superfamily protein, putative isoform 1
STRINGPOPTR_0015s05340.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-55G2-like family protein