PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001639-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family YABBY
Protein Properties Length: 213aa    MW: 23467.8 Da    PI: 8.3921
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001639-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2391e-73121753170
               YABBY   3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee..lleelkveeenlksnvekees 91 
                           s s+q+Cyv+CnfC+t+lavsvP +s+fk+vtvrCGhCt+llsvn++      a + hl++++  +  lle  +++ +n+  n   + +
  WALNUT_00001639-RA  12 NLSPSDQLCYVHCNFCDTVLAVSVPCSSMFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHTFFTPqnLLEGIRSSPSNIMIN---QPN 99 
                         56889****************************************9999998888888899999876534666666666666544...445 PP

               YABBY  92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                         +++ v+     +  +ee+p++  v rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  WALNUT_00001639-RA 100 PNELVPP---ARGAQEETPKPLIVTRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 175
                         5555555...467899****999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.2E-7215175IPR006780YABBY protein
SuperFamilySSF470954.84E-8119168IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.7E-4124167IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MSASSAAFSP DNLSPSDQLC YVHCNFCDTV LAVSVPCSSM FKTVTVRCGH CTNLLSVNMR  60
GLLLPAANQL HLGHTFFTPQ NLLEGIRSSP SNIMINQPNP NELVPPARGA QEETPKPLIV  120
TRPPEKRQRV PSAYNRFIKD EIQRIKAGNP DISHREAFSA AAKNWAHFPH IHFGLMPDQP  180
VKRTNVVRQQ EGEDVLMKDG FLAPANVGVS PSY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007052113.11e-135Plant-specific transcription factor YABBY family protein isoform 1
SwissprotO221527e-92YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A061DU751e-135A0A061DU75_THECC; Plant-specific transcription factor YABBY family protein isoform 1
STRINGVIT_15s0048g00550.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.14e-93YABBY family protein