PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001591-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 296aa    MW: 33143.2 Da    PI: 6.9011
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001591-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-18145199256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq  +Lee F+++++++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  WALNUT_00001591-RA 145 RKKLRLSKEQSLVLEETFKEHNTLNPKQKLGLAKQLNLSPRQVEVWFQNRRARTK 199
                         788899***********************************************98 PP

2HD-ZIP_I/II125.81.9e-40145234191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+ +LEe+F+e+++L+p++K  la++L+l+prqv+vWFqnrRARtk+kq+E+dye+Lkr++++l+een+rL+kev+eLr +l
  WALNUT_00001591-RA 145 RKKLRLSKEQSLVLEETFKEHNTLNPKQKLGLAKQLNLSPRQVEVWFQNRRARTKLKQTEMDYEYLKRCCENLTEENRRLQKEVQELR-AL 234
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576134No hitNo description
PfamPF046181.5E-239115IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.9E-18140206IPR009057Homeodomain-like
PROSITE profilePS5007117.459141201IPR001356Homeobox domain
SMARTSM003891.2E-16143205IPR001356Homeobox domain
SuperFamilySSF466891.67E-19143210IPR009057Homeodomain-like
PfamPF000463.0E-16145199IPR001356Homeobox domain
CDDcd000865.99E-16145202No hitNo description
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
PfamPF021833.5E-11201235IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-26201244IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGEIREKTGE KDDGLGLGLG LGLGLSLGLG FLGCDGNRSS VKVSPMHNPS QFVQKHKGSW  60
NEMFQLPDRN PDARSTFLGG VDVNQLPSMA DCEDENGVSS PNSTISSISG KRSERSEPNG  120
EENEAERDSC SRESDEEDGG GDPSRKKLRL SKEQSLVLEE TFKEHNTLNP KQKLGLAKQL  180
NLSPRQVEVW FQNRRARTKL KQTEMDYEYL KRCCENLTEE NRRLQKEVQE LRALKLSPQF  240
YMHMNPPTTL TMCPSCERVA PSTAAPIGRT RRLVVPNDVQ RPPWPTLPYD APASRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143149SRKKLRL
2193201RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018819673.10.0PREDICTED: homeobox-leucine zipper protein ATHB-4-like
SwissprotP466021e-93HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A2I4EJV00.0A0A2I4EJV0_JUGRE; homeobox-leucine zipper protein ATHB-4-like
STRINGXP_006464444.11e-119(Citrus sinensis)
STRINGXP_006445396.11e-119(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-76homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]