PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001242-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 448aa    MW: 49484 Da    PI: 7.6393
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001242-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32260313255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  WALNUT_00001242-RA 260 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 313
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15257313IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28258313IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23260313IPR006447Myb domain, plants
PfamPF002498.3E-7261312IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MKMPLEGIFI EPSSTPLPDL SLHISPPNTS SSLTSTDEPD ISFDLLSHRE AHNSKSNSST  60
RTESQAQTEL SLGRNSRCGA EDSRPHDPYQ QQNHLLQLSK NHLNHKNRGV SLLDVSSDSL  120
RPIKGIPVYH SRSFPFLPMD PARDKDPKMS FYPIPSYPSL SSCSALCTPS VSHSPSPYYR  180
GGLDPMSIFH SGSNASSAAY RLGATTSFNG LSTDSLKALQ LHHHQQQNQY GVGASEASHH  240
GMIRSRFLPK LPTKRSMRAP RMRWTSTLHA RFVHAVELLG GHERATPKSV LELMDVKDLT  300
LAHVKSHLQM YRTVKTTDKP AASSGQSDGS GEDEISPVGS AGDRGLRPLT DQRGPPDRPL  360
QQEIDYPSIT LWSNSSSREA WVQANNNDMD QGLKPAASFE SQQRSRAHHW QECGSTQLKS  420
YLGSNLDSMN PSLEFTLGIP DWHGKEHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16261315458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018816533.10.0PREDICTED: transcription repressor KAN1-like isoform X3
TrEMBLA0A2I4EAV40.0A0A2I4EAV4_JUGRE; transcription repressor KAN1-like isoform X3
STRINGVIT_04s0043g00340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-71G2-like family protein