PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001229-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 596aa    MW: 66214.8 Da    PI: 7.633
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001229-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox421.6e-133411856
                        HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +F+  ++p++++r++L+++l+L+ +q+k+WFqN+R++ k
  WALNUT_00001229-RA  3 FFKDYPHPDEKQRRQLSRRLELEPKQIKFWFQNKRTQTK 41
                        59999******************************9987 PP

2START22.81.8e-08155259389
                         HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a  a++el+++   +ep+W ks   ++g +vl  ++ +k             ++e +++s +v+   + lve +ld+  +W   ++    k
  WALNUT_00001229-RA 155 AAGAMDELIRLLRINEPLWIKSL--DDGRYVLHHESYGKLfptinhfrnpsARVESSKDSDIVTVSGMHLVEMILDSE-KWVDLFPtivtK 242
                         6679*******************..9999999999888878999999*******************************.99999988889* PP

                         EEEEEEECTT......E CS
               START  79 aetlevissg......g 89 
                         a+t++v+++g      g
  WALNUT_00001229-RA 243 AKTIQVLETGtlgnrsG 259
                         *********96555555 PP

3START43.21.1e-14272332147206
                         ESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 147 llpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         ++pSg++i++++ng skvtwvehv+++++   h l+r l+  +la ga +w  tl+r ce+
  WALNUT_00001229-RA 272 RFPSGCMIQEMPNGCSKVTWVEHVEVDDKNQtHRLYRDLICGSLAYGAERWIVTLKRMCER 332
                         79************************988766***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.637143IPR001356Homeobox domain
SMARTSM003890.0095247IPR001356Homeobox domain
PfamPF000466.4E-11341IPR001356Homeobox domain
SuperFamilySSF466891.28E-10352IPR009057Homeodomain-like
CDDcd000869.01E-11344No hitNo description
Gene3DG3DSA:1.10.10.601.2E-11349IPR009057Homeodomain-like
PROSITE patternPS0002701841IPR017970Homeobox, conserved site
PROSITE profilePS5084815.194144253IPR002913START domain
SuperFamilySSF559619.48E-14145334No hitNo description
CDDcd088752.16E-74148331No hitNo description
PfamPF018527.6E-10271332IPR002913START domain
PROSITE profilePS5084816.713272335IPR002913START domain
SuperFamilySSF559612.33E-12353560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MVFFKDYPHP DEKQRRQLSR RLELEPKQIK FWFQNKRTQT KAQHERADNS VLRSENDRIQ  60
CENVAIREAL KNHEKVSNLL AKYIGKPISQ FESLIPMVPR SSLGFSPGTS MNQRLGNPAL  120
DLDLSYSPAS SNNTAFLYQL KGIPNMEKAL MLETAAGAMD ELIRLLRINE PLWIKSLDDG  180
RYVLHHESYG KLFPTINHFR NPSARVESSK DSDIVTVSGM HLVEMILDSE KWVDLFPTIV  240
TKAKTIQVLE TGTLGNRSGS LQLNIPPSCS WRFPSGCMIQ EMPNGCSKVT WVEHVEVDDK  300
NQTHRLYRDL ICGSLAYGAE RWIVTLKRMC ERFSYSNGEI TPSHELGGEF SSPEGRRSVM  360
KLSHRMVKNF CGILSMSGKL DFPHQLSELY NSGVRVSVHK SREPGQPGGI IVSAATSLWL  420
PLPPQNVFDF IREEKMRVQW DVLSDGKPVH EISRISIGAH LGNSISIIQP FIPAESNMLM  480
LQESWIDSLG SLVVYAPIDM PSISMAMSGE DPSNIPILPS GFVISSDGHP ETGSAGASTS  540
KNAGMSGGSL LTVAFQILVS SPSSKQLNME SVATVNTLIS STVQRIKAAL NCSGLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526595.20.0PREDICTED: homeobox-leucine zipper protein ROC8 isoform X2
SwissprotQ9FX311e-179HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLM5WQX60.0M5WQX6_PRUPE; Uncharacterized protein
STRINGVIT_04s0079g00480.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-174homeodomain GLABROUS 11