PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001185-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 260aa    MW: 29766.2 Da    PI: 10.1856
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001185-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.5e-32192246256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         +r+ Wt eLH++Fveav+ LGG+e+AtPk+i+e+m+v+gLt++hvkSHLQkYRl+
  WALNUT_00001185-RA 192 NRRTWTVELHAKFVEAVNFLGGPEVATPKQIREVMQVEGLTNDHVKSHLQKYRLH 246
                         799**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.938188248IPR017930Myb domain
SuperFamilySSF466892.51E-16190248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27190247IPR009057Homeodomain-like
PfamPF002491.1E-7193244IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.0E-25193246IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MESVGVNPLE LSLSLKPSYF PKTITNLLKD LRNMNNVWEK LSVLAESLQM HKEELARLEV  60
FKRELPQSAL LLMESIDILE EEIEKVKNKE SEAERPLMEF LTLKNRRINF DDQKEHERQI  120
LGSNGVGKAQ ASSPAFLSNR DHCHLDTSTR PCKFNSGKAR GKEVMNGSGM SSVHPKARVP  180
KPFKPKPIRK TNRRTWTVEL HAKFVEAVNF LGGPEVATPK QIREVMQVEG LTNDHVKSHL  240
QKYRLHNKIF RSQDSSSTSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032891.13e-53DNA binding protein, putative
TrEMBLA0A061EHD13e-53A0A061EHD1_THECC; DNA binding protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148661012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-28G2-like family protein