PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00000575-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 180aa    MW: 20660.4 Da    PI: 7.2946
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00000575-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-181970556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++++q++ Le+ F +++++  e++ +LA++lg++ rqV +W+qN+Ra++k
  WALNUT_00000575-RA 19 KRLNPDQVKLLERSFTSSNKLEPERKLQLANQLGVPPRQVAIWYQNKRARWK 70
                        56899**********************************************9 PP

2HD-ZIP_I/II109.32.8e-3517108293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                          k+rl+ +qvklLE+sF++++kLeperK +la++Lg+ prqva+W+qn+RAR+kt+ lE dy++L++++++   e++ Lek+ve+L+ el+
  WALNUT_00000575-RA  17 MKKRLNPDQVKLLERSFTSSNKLEPERKLQLANQLGVPPRQVAIWYQNKRARWKTQSLELDYNVLQQKLENALFEKRLLEKDVERLKGELE 107
                         59*************************************************************************************9998 PP

         HD-ZIP_I/II  93 e 93 
                         +
  WALNUT_00000575-RA 108 K 108
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.5971272IPR001356Homeobox domain
SuperFamilySSF466891.97E-171482IPR009057Homeodomain-like
SMARTSM003893.1E-141476IPR001356Homeobox domain
PfamPF000463.1E-151870IPR001356Homeobox domain
CDDcd000868.90E-131873No hitNo description
Gene3DG3DSA:1.10.10.604.6E-181979IPR009057Homeodomain-like
PRINTSPR000317.4E-54352IPR000047Helix-turn-helix motif
PROSITE patternPS0002704770IPR017970Homeobox, conserved site
PRINTSPR000317.4E-55268IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MDFFRSQNQK HTPKHNMKKR LNPDQVKLLE RSFTSSNKLE PERKLQLANQ LGVPPRQVAI  60
WYQNKRARWK TQSLELDYNV LQQKLENALF EKRLLEKDVE RLKGELEKAQ EMVIALKQTG  120
GTDQVCCNSV SFEEAATRSS SLKEGVNCSA ENSKGEDQEV FPVLEDLYAC LIGVDGSSWD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018847117.11e-132PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLA0A2I4GT941e-130A0A2I4GT94_JUGRE; homeobox-leucine zipper protein ATHB-52-like
STRINGXP_008226425.14e-61(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110112239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.11e-33homeobox protein 52