PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00000297-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family CPP
Protein Properties Length: 803aa    MW: 87578.7 Da    PI: 5.1836
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00000297-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.63.2e-15507546241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++k+CnCk+skClk+YCeCfaag +C  +C Ce C+Nk e
  WALNUT_00000297-RA 507 DCKRCNCKRSKCLKLYCECFAAGIYCVGSCACETCFNKPE 546
                         689**********************************976 PP

2TCR50.54e-16594632139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkkskClkkYCeC++a++ Cs+ C+C++C+N+
  WALNUT_00000297-RA 594 RHKRGCNCKKSKCLKKYCECYQAKVGCSDGCRCDGCQNS 632
                         589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-14506547IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.637507634IPR005172CRC domain
PfamPF036384.3E-11509544IPR005172CRC domain
SMARTSM011149.8E-17594635IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11596632IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MDSPEGNPVA ASSSPISSDS PPVQESPFFN YLCNLSPIKS VKAERYTQRF TETNLPTPPL  60
VFTSPRIDLQ RDTSFLERDN VAATDSIVHE NFNTQLNVVH IPSFEKEGQS CSPAGCIDEY  120
LVDPMEVDST NSTHLGLQSA EEVPELLQSG YAGLKGTIKK VDDAVDSNRE EGALTLCDPA  180
EKNLNLSPLK LVESAVDLRN DERFDDFLKG LTSEKAKDIV DADMKLNPVS GVQHCERHAA  240
QIEGVQQDEG DGTCQSLDEP LQINEACEDF DDGSRTLPKE FVKGANNCRG TRRHLHFEAT  300
LACKSIATGN TANPKASITN LKSLAPISSS WDAAGYPLSI TSQASCCPLK VARSTQNIGN  360
SEILSPLPTG IGLHVNSIGR SMLSGSDVFT SKNLNLSSQD KLVPEWSNDL VKDPNNISNS  420
AIAGTMFSHA DLDQQESQAG VAASSTSYPI NSLNPPCDSP LTQIELQVAP CEGRISAQQN  480
ADSIDELNQM SPKRKRKSTA NKSESGDCKR CNCKRSKCLK LYCECFAAGI YCVGSCACET  540
CFNKPEYEDL VLDTREQIES RNPLAFAPKI VKQTTESPAN VMEEGNWTTP SSARHKRGCN  600
CKKSKCLKKY CECYQAKVGC SDGCRCDGCQ NSFGIKSDYR RAERCDNLSH EKLQIAESEK  660
NGSSKQFSPT SWEGLADMRN LDPCSEISQA QLQLASNIQS SAASLHWRYS PVTLTPKLCG  720
GNGPHELTSD SAFCNMEDND MLEILKDTTN THRAEGQRSS SPRGLRCGRK FILQAVPSFP  780
PLTPYKTVSS KLKNDQTDSA ANR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1750963112120Protein lin-54 homolog
5fd3_B1e-1750963112120Protein lin-54 homolog
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1491497PKRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018827589.10.0PREDICTED: uncharacterized protein LOC108996265
RefseqXP_018827590.10.0PREDICTED: uncharacterized protein LOC108996265
TrEMBLA0A2I4F7G60.0A0A2I4F7G6_JUGRE; uncharacterized protein LOC108996265
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF142771417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.19e-60TESMIN/TSO1-like CXC 2