PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4U30989.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRF
Protein Properties Length: 519aa    MW: 56592.9 Da    PI: 5.9733
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4U30989.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24194236244
            WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Jcr4U30989.10 194 LEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVE 236
                    69**************************************986 PP

2QLQ58.91.5e-20131163234
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                    +FT+aQ+ +L++Q+++yKy++a++PvPp+Ll +
  Jcr4U30989.10 131 PFTNAQWKELERQAMIYKYMMASVPVPPHLLIP 163
                    8*****************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.8E-13130166IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.9E-14131163IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.083131166IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.727193237IPR014977WRC domain
PfamPF088791.1E-20195236IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MTIDGFSVLD KAAKESFDSA FDDLGVKLQL QNQQHTQSFP FSNMMFVDHN DNNPYRPFPS  60
SGFGDIGPTR IKNRRCFISS NDNIGGGHSD TDRGHCAVIS SSVAGGLRSL QPFAAFKSES  120
AGGMAASLGF PFTNAQWKEL ERQAMIYKYM MASVPVPPHL LIPTSRNFPL DPTVASHHLL  180
GSGLNLKFTN GADLEPGRCK RTDGKKWRCS RDVAPDQKYC ERHMHRGRPR SRKPVELLSN  240
TNTTNNKKIR YTSAESASNN NNGVVSEFDD TLAQPYLQAP VFLDNPNCKV ANFDTSVAFA  300
SSFKEPRSMN WVVKGPGDQQ WQNTEIGLSS DSVLNPDYQE QALNLNPFGN FSRGEDQQSN  360
NQSTLFFDDK FSHGVLNDPS ANCRNRNSSV SSNGKLLNAA LSLSIDGSIS SMNEEMGQIQ  420
MGLGLIESDQ IGECCTKPMA LAPASWTEAA TPGGPLAEVL QLSSVANQLS PVAEIENGDY  480
CSTPQATAVY SPSGVVQKEL PTSFSDSSNN SVYQHLQVL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086613.20.0growth-regulating factor 7 isoform X1
TrEMBLA0A067LEL60.0A0A067LEL6_JATCU; Uncharacterized protein
STRINGXP_002521932.11e-143(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.12e-42growth-regulating factor 8