PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S25406.20
Common NameGRAS11, JCGZ_24699, LOC105631672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRAS
Protein Properties Length: 545aa    MW: 61122.1 Da    PI: 6.422
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S25406.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS261.82.3e-801605372374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                    ++lL  cA a+++g+l+++q+lL  l+elas++gd+++Rla+y ++AL ++l++  s++ ++++p + ++++ +    +l  f+evsP++ f + +
  Jcr4S25406.20 160 EHLLNPCAAAITTGNLSRVQHLLYVLHELASSTGDANHRLAFYGLRALTHHLSS--STTTASIAPISFASTEPKFFQRSLLKFYEVSPWFAFPNNI 253
                    699**************************************************9..55555676777765666666666666************** PP

           GRAS  98 aNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRpeg.ppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefn 179
                    aN+ Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ R++g pp +RiT++ +  ++               +   rL +fA+++++++++n
  Jcr4S25406.20 254 ANSSILQVLAKEqdhkRNLHILDIGVSHGVQWPTLLEALTRRSGGlPPLVRITVITATIENdqdtetpflVGPPGDNFSPRLLSFAKSMNINLQIN 349
                    *********9998877789************************66488******99865556666666666677789999**************** PP

           GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerflealeyysalfdsle 272
                     l+   l++l+ + ++ +++E+l+V+ +++l +l    +++++er+e+L+++++l+Pk v+++e+++d+  ns ++F+++f++ ++y ++++ds++
  Jcr4S25406.20 350 RLHNYPLKNLNAQVIKSNSDETLIVCAQFRLNHLN---HNTPDERTEFLRVLRELEPKGVILSENNTDCscNScGDFATGFSRRVDYLWKFLDSTS 442
                    *9999*****************************8...77777889*******************96664354259*******************7 PP

           GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                    + +    + r + Er++++ e+ ++++++g++    +e +ekW er++++GF    ++e+a +  ++llrk++ ++++r+ee+ +++ l Wk++p+
  Jcr4S25406.20 443 SAF----KGRESEERRVMEGEAAKALTNRGEM----NEGKEKWCERMTRVGFVGEMFGEDAIDGGRALLRKYDsNWEMRIEEKGECVGLWWKGHPV 530
                    775....6677777777777899999999998....9************************************9999******************* PP

           GRAS 368 vsvSaWr 374
                     ++S W+
  Jcr4S25406.20 531 SFCSLWK 537
                    ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.265133516IPR005202Transcription factor GRAS
PfamPF035148.1E-78160537IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MTIEETEANH ISDHILDWIE DTVPFLPSFL DDPYSSDDIN SYHQWWNQTE ELCQDPINTD  60
TNLTAITITT TNDKLTEESN PTITSSPQPS NSSRKRGSPD DSVQNHQQRK KQSHRAVSNE  120
EKDGGAVVTG KRSNGTKKSN SKSTGNNSNN GNSKEGRWAE HLLNPCAAAI TTGNLSRVQH  180
LLYVLHELAS STGDANHRLA FYGLRALTHH LSSSTTTASI APISFASTEP KFFQRSLLKF  240
YEVSPWFAFP NNIANSSILQ VLAKEQDHKR NLHILDIGVS HGVQWPTLLE ALTRRSGGLP  300
PLVRITVITA TIENDQDTET PFLVGPPGDN FSPRLLSFAK SMNINLQINR LHNYPLKNLN  360
AQVIKSNSDE TLIVCAQFRL NHLNHNTPDE RTEFLRVLRE LEPKGVILSE NNTDCSCNSC  420
GDFATGFSRR VDYLWKFLDS TSSAFKGRES EERRVMEGEA AKALTNRGEM NEGKEKWCER  480
MTRVGFVGEM FGEDAIDGGR ALLRKYDSNW EMRIEEKGEC VGLWWKGHPV SFCSLWKLDV  540
KGNGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-221605376375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4052790.0KM405279.1 Jatropha curcas GRAS11 protein (GRAS11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069237.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A067L8A60.0A0A067L8A6_JATCU; GRAS11 protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-160GRAS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]