PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S16123.20
Common NameJCGZ_13676, LOC105639075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GATA
Protein Properties Length: 341aa    MW: 37493.7 Da    PI: 5.493
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S16123.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18258291134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +
  Jcr4S16123.20 258 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGR 291
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.9E-811339IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.899252288IPR000679Zinc finger, GATA-type
SMARTSM004014.3E-15252306IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.04E-14254315No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14256289IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.84E-14257305No hitNo description
PfamPF003201.8E-16258291IPR000679Zinc finger, GATA-type
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MECVEVALKT SISRQEMAFK FNQQDSCDDT WTVNVQNGST FDDSIVDELL DFSNEPGFIG  60
GDDEEEEEEN VCTACVSPKQ KALEADKLSN DKSSDYDFGS VPASELGVPV DDLSSLEWLS  120
HFVEDSNSEY SAPFPAVIVA AKPKQENYRF EPQNPVLITE PCFNTPVPAK ARSKRTRTSV  180
KVRNLWSSSL TESSSSSSST TSSSSSNPSS PCLVFPSPGM SHELTEKSVF YVKPPAKKLK  240
KRPAGEYAGG GSQPPRRCSH CGVQKTPQWR TGPLGAKTLC NACGVRFKSG RLFPEYRPAC  300
SPTFSSELHS NHHRKVLEMR KKKEQSDQPE TDLAPSVVPS F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078406.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH573e-77GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A067KCD80.0A0A067KCD8_JATCU; Uncharacterized protein
STRINGPOPTR_0005s11960.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-72GATA transcription factor 5
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]