PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S12729.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 166aa    MW: 18880.3 Da    PI: 9.7794
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S12729.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.77.9e-3370126158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    +ep++VNaKQy++Il+RRq+Rak+e+e+k+ +ksrkpylheSRh+hAlrR+Rg gGrF
  Jcr4S12729.20  70 EEPVFVNAKQYHGILRRRQSRAKAESENKV-IKSRKPYLHESRHQHALRRARGLGGRF 126
                    69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.6E-3768129IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.81869129IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.7E-2871126IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-247294IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607494IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-24103126IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MQNTMCITWT PFYLKAAAAY PYPDPYYRSI FAPYDAQPYP PQPYGGQPMV HLQLMGIQQA  60
GVPLPTDAVE EPVFVNAKQY HGILRRRQSR AKAESENKVI KSRKPYLHES RHQHALRRAR  120
GLGGRFLNSK KNENREQKEV ASGDKSQSNI NLNCDKNDIA SSDSQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-2269134166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826932e-46AC182693.2 Populus trichocarpa clone Pop1-44N6, complete sequence.
GenBankAC1878642e-46AC187864.2 Populus trichocarpa clone Pop1-32E3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075625.11e-110nuclear transcription factor Y subunit A-7 isoform X4
RefseqXP_012075626.11e-110nuclear transcription factor Y subunit A-7 isoform X4
SwissprotQ84JP11e-61NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A067KSV91e-108A0A067KSV9_JATCU; Uncharacterized protein
STRINGXP_002523193.11e-96(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53793355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-42nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]