PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S11849.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 156aa    MW: 18006.8 Da    PI: 10.0154
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S11849.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.41.6e-40141131100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCa+Ck++rrkC+k+C+lapyfpa+q+++f+n+++lFG++n+lk+lk+++++e++++m+s++ye+++rar Pv+G++g+il+lq q eq+k+++ +
  Jcr4S11849.10  14 ACAVCKYQRRKCTKECALAPYFPADQQRTFRNARRLFGVHNILKILKQVKDDEKDETMRSIIYESNMRARFPVHGCLGIILHLQYQAEQVKQQILH 109
                    7********************************************************************************************998 PP

         DUF260  97 lkee 100
                    +k++
  Jcr4S11849.10 110 AKRQ 113
                    8877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.83913114IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3714110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MMKKEDTIPK TSQACAVCKY QRRKCTKECA LAPYFPADQQ RTFRNARRLF GVHNILKILK  60
QVKDDEKDET MRSIIYESNM RARFPVHGCL GIILHLQYQA EQVKQQILHA KRQIEICKKH  120
QCDGFVNSDG IGTRTGIGTA KGKKSDDIVE PRRNQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2361143111LOB family transfactor Ramosa2.1
5ly0_B1e-2361143111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020538028.11e-111LOB domain-containing protein 25-like
TrEMBLA0A1Q3DC131e-46A0A1Q3DC13_CEPFO; DUF260 domain-containing protein (Fragment)
STRINGXP_008459693.15e-48(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-34LOB domain-containing protein 27