PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S11843.10
Common NameJCGZ_26740, LOC105630095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GATA
Protein Properties Length: 336aa    MW: 37836.1 Da    PI: 5.469
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S11843.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18255288134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Jcr4S11843.10 255 CSHCHVQKTPQWRTGPLGAKTLCNACGVRYKSGR 288
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-7521335IPR016679Transcription factor, GATA, plant
SMARTSM004011.5E-13249299IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.464249285IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-14252312No hitNo description
Gene3DG3DSA:3.30.50.101.9E-14253286IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.73E-14254303No hitNo description
PfamPF003202.1E-16255288IPR000679Zinc finger, GATA-type
PROSITE patternPS003440255280IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MEYCMVARAL KPSLRRELAS KSTQQAFFED FLCSNSNNGV VSCEDFSVDC FFDFSNGEFK  60
DSYIQELEEE EEGDEEEKDF VSVSSQERVD DDNNSNFSNF SDSFLTSQPV EELAELEWVS  120
QIVDDSSSEF PLLYPLETDN QNHVMNRFQK PQPQPEPVYS KPSCLFPSKI PAKARSKRSR  180
LTSHTWSGSC IIDSSSTLSS SSSTTSSVAS TPFVLTSSVP TIDSFPTEPL IKKPKKKAVV  240
QTIGLTNSTQ FQRRCSHCHV QKTPQWRTGP LGAKTLCNAC GVRYKSGRLF PEYRPACSPT  300
FSEEVHSNSH RKVLEIRKRK EMTGQDSGLN QMVHSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067181.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A067L0030.0A0A067L003_JATCU; Uncharacterized protein
STRINGPOPTR_0009s12620.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-52GATA transcription factor 5
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]