PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S11083.10
Common NameJCGZ_10020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family B3
Protein Properties Length: 228aa    MW: 26154.6 Da    PI: 10.1618
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S11083.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.11.7e-18127207487
                    E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
             B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                    vl+++++ ++++l++p kfa+++ +   ++k ++l+ ++g++W v l  +++ gr +l+kGWk F+++n L+ gD+++F+l+++
  Jcr4S11083.10 127 VLLRPYNCRNSILYVPSKFAKRYLSR--GPKNIKLQVSDGKEWAVCLL-QQGYGRSLLGKGWKIFCRENTLEGGDVCLFELINN 207
                    67789999***************544..6778***************5.55556779***********************9974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.0E-111483IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-121583IPR015300DNA-binding pseudobarrel domain
CDDcd100171.48E-62081No hitNo description
PROSITE profilePS508637.5562184IPR003340B3 DNA binding domain
SMARTSM010191.322107IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-26117216IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-24118216IPR015300DNA-binding pseudobarrel domain
CDDcd100179.11E-19123215No hitNo description
PROSITE profilePS5086314.706124218IPR003340B3 DNA binding domain
SMARTSM010193.3E-15125219IPR003340B3 DNA binding domain
PfamPF023621.0E-16127207IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
CPQKVEKAIR AARMLQPKNP SFMVVLRSSS LMKNIVCVPI RFARRYLSRG LEFIKIQDSD  60
GRDWSVNLCW DSHRVNLGRG WNSVENYKED LEIITSEMFG CAKPSPESQR AIEAARMLKP  120
KNPSFMVLLR PYNCRNSILY VPSKFAKRYL SRGPKNIKLQ VSDGKEWAVC LLQQGYGRSL  180
LGKGWKIFCR ENTLEGGDVC LFELINNYVL KVFIFHAVEI SNPKIMAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-2110521929144B3 domain-containing transcription factor VRN1
4i1k_B2e-2110521929144B3 domain-containing transcription factor VRN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020534852.11e-155B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067LMY11e-154A0A067LMY1_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-22B3 family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]