PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07682.20
Common NameJCGZ_24720, LOC105631414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 282aa    MW: 31161.6 Da    PI: 8.0361
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07682.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.61.5e-31124180158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    dep++VNaKQy++Il+RR  Rakle+++kl +k+rkpylheSRh hAlrR+RgsgGrF
  Jcr4S07682.20 124 DEPIFVNAKQYNAILRRRRYRAKLEAQNKL-IKARKPYLHESRHLHALRRARGSGGRF 180
                    79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-36122183IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.27123183IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-26125180IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-22126148IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860128148IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-22157180IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGVPQHFHGS KKLTFQLQDQ DSSSTQSTSQ SYPEVASIEE GFNDSHEKAE GGHIKLASSM  60
GTQDFIFPSQ VDYSQSLGRF PIHFAEPYYG GLLAAYGPQT MIHHPQVFGM ASARVPLPLE  120
FTEDEPIFVN AKQYNAILRR RRYRAKLEAQ NKLIKARKPY LHESRHLHAL RRARGSGGRF  180
LNAKKHPESG IPTSHGLDTA GSGELHLAGN MSESEVHQPE NHRDGASTTS CSDVTSASNS  240
DDIFQQPEFK FSGYPSHIIR SMQGRSGSMH GSGSHHHVSV LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18124184262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068910.10.0nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_012068912.10.0nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_020533875.10.0nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_020533876.10.0nuclear transcription factor Y subunit A-3 isoform X1
SwissprotQ93ZH21e-72NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A067KX270.0A0A067KX27_JATCU; Uncharacterized protein
STRINGXP_002521352.11e-160(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-64nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]