PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S06647.20
Common NameJCGZ_25558, LOC105646532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 327aa    MW: 36264.5 Da    PI: 8.4848
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S06647.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.6e-18169223256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Jcr4S06647.20 169 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 223
                    788899***********************************************98 PP

2HD-ZIP_I/II127.84.6e-41169259192
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                    +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+ke +eLr +lk
  Jcr4S06647.20 169 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELR-ALK 259
                    69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.4E-627127IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466894.28E-18162226IPR009057Homeodomain-like
PROSITE profilePS5007116.763165225IPR001356Homeobox domain
SMARTSM003897.7E-15167229IPR001356Homeobox domain
CDDcd000861.54E-15169226No hitNo description
Gene3DG3DSA:1.10.10.604.6E-17169223IPR009057Homeodomain-like
PfamPF000463.2E-15169223IPR001356Homeobox domain
PROSITE patternPS000270200223IPR017970Homeobox, conserved site
PfamPF021838.5E-11225259IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-24225268IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MELALSLGDT SKPFKFLDIN PTNISTKDLG FCMALGTGFN GKSHHSGEGD KVLPSDPPLQ  60
LDLLPFSPVP RQNPSSQIRF PWLTDNLVSE PGSTDGSGRG FDVNRLSAEE AEEAAALSSP  120
NNAVSSFQMD FGIRSSGGSR GNKRDIEGVN ETERASSRAS DDEENGLARK KLRLSKEQSA  180
FLEESFKEHN TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEYLRRCCET  240
LTEENRRLQK ELQELRALKT SQPFYKQLPA TTLTMCPSCE RVATTTPSST TAIATTTNNT  300
NSKSLSLAKP RSYPFSNSHD SSSLRCN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217225RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629445e-91AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087785.10.0homeobox-leucine zipper protein HOX11 isoform X1
SwissprotP466651e-102HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A067JL530.0A0A067JL53_JATCU; Uncharacterized protein
STRINGcassava4.1_010584m1e-165(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-85homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]