PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S06476.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family M-type_MADS
Protein Properties Length: 235aa    MW: 27478.7 Da    PI: 9.5735
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S06476.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.55.5e-16446345
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   i+ +s r  tf kR++ +lKK +E S+LC++e+++iif++++k
  Jcr4S06476.10  4 IKKESTRIHTFQKRKKSLLKKVSEFSILCGVEACLIIFGPKQK 46
                   8899999*********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-6159IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-16180IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.946146IPR002100Transcription factor, MADS-box
CDDcd002661.47E-17184No hitNo description
PfamPF003195.4E-16446IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-51631IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-53152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MELIKKESTR IHTFQKRKKS LLKKVSEFSI LCGVEACLII FGPKQKNLEK EKLEAHWPSN  60
SDEVKHIINR YKKTKRARCY HISDYFLDKK KKVDIEISKL LKQIYQAKYP SWSIHLDSFV  120
EDQLRILLAQ LDKKLEPGQS SVMIPEKNNN LQLFSEYHKA MMTGHLTGKN DTDNNLGNLQ  180
MKLFNQELME DRMRNMSNDQ NVSNQFGGSL ISNIPSSSGL PYVNPSCWMW DNEMY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072699.21e-137agamous-like MADS-box protein AGL82
TrEMBLA0A067LN791e-136A0A067LN79_JATCU; Uncharacterized protein
STRINGcassava4.1_025079m4e-70(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-21AGAMOUS-like 82